Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3714930..3715624 | Replicon | chromosome |
| Accession | NZ_LS483296 | ||
| Organism | Escherichia coli strain NCTC9966 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1EXB8 |
| Locus tag | DQM96_RS19500 | Protein ID | WP_001263493.1 |
| Coordinates | 3714930..3715328 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | DQM96_RS19505 | Protein ID | WP_000554757.1 |
| Coordinates | 3715331..3715624 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - | 3710589..3710669 | - | 81 | NuclAT_8 | - | - |
| - | 3710589..3710669 | - | 81 | NuclAT_8 | - | - |
| - | 3710589..3710669 | - | 81 | NuclAT_8 | - | - |
| - | 3710589..3710669 | - | 81 | NuclAT_8 | - | - |
| DQM96_RS19475 | 3711265..3711723 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| DQM96_RS19480 | 3711984..3713441 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
| DQM96_RS19485 | 3713498..3714019 | - | 522 | Protein_3564 | peptide chain release factor H | - |
| DQM96_RS19490 | 3714018..3714221 | - | 204 | Protein_3565 | RNA ligase RtcB family protein | - |
| DQM96_RS19495 | 3714468..3714920 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
| DQM96_RS19500 | 3714930..3715328 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| DQM96_RS19505 | 3715331..3715624 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| DQM96_RS19510 | 3715676..3716731 | - | 1056 | WP_111724751.1 | DNA polymerase IV | - |
| DQM96_RS19515 | 3716802..3717587 | - | 786 | WP_000207587.1 | putative lateral flagellar export/assembly protein LafU | - |
| DQM96_RS19520 | 3717559..3719271 | + | 1713 | Protein_3571 | flagellar biosynthesis protein FlhA | - |
| DQM96_RS19525 | 3719487..3719984 | - | 498 | WP_000006256.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T292169 WP_001263493.1 NZ_LS483296:c3715328-3714930 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|