Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 1528143..1528798 | Replicon | chromosome |
| Accession | NZ_LS483259 | ||
| Organism | Bordetella pertussis strain BP6242 isolate Bordetella pertussis | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | - |
| Locus tag | JMW36_RS07335 | Protein ID | WP_047122780.1 |
| Coordinates | 1528143..1528394 (+) | Length | 84 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | Q7VY40 |
| Locus tag | JMW36_RS07340 | Protein ID | WP_003809516.1 |
| Coordinates | 1528397..1528798 (+) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW36_RS07310 | 1523304..1524434 | - | 1131 | WP_010930401.1 | helix-turn-helix transcriptional regulator | - |
| JMW36_RS07315 | 1524669..1525250 | + | 582 | WP_019247931.1 | molybdenum cofactor biosysynthesis protein | - |
| JMW36_RS07320 | 1525387..1526451 | + | 1065 | WP_003809510.1 | fructose-bisphosphate aldolase class II | - |
| JMW36_RS07325 | 1526536..1526982 | - | 447 | WP_003819827.1 | GFA family protein | - |
| JMW36_RS07330 | 1527207..1528088 | + | 882 | WP_003809513.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| JMW36_RS07335 | 1528143..1528394 | + | 252 | WP_047122780.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
| JMW36_RS07340 | 1528397..1528798 | + | 402 | WP_003809516.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
| JMW36_RS07345 | 1528818..1529054 | + | 237 | WP_010930404.1 | membrane protein | - |
| JMW36_RS07350 | 1529062..1529541 | + | 480 | WP_010930405.1 | disulfide bond formation protein B | - |
| JMW36_RS07355 | 1529691..1530206 | + | 516 | WP_019247930.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
| JMW36_RS07360 | 1530209..1531399 | + | 1191 | WP_010930406.1 | 5-(carboxyamino)imidazole ribonucleotide synthase | - |
| JMW36_RS07365 | 1531419..1532456 | + | 1038 | WP_023853543.1 | threonylcarbamoyl-AMP synthase | - |
| JMW36_RS07370 | 1532593..1533615 | + | 1023 | WP_003809532.1 | amino acid ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 84 a.a. Molecular weight: 8952.52 Da Isoelectric Point: 9.7242
>T292152 WP_047122780.1 NZ_LS483259:1528143-1528394 [Bordetella pertussis]
IGGAATKKPGQKRRAGAAALGLDFSAMVEIVLALTPRDFHKSMTTHADHRIWQDVYCPVTAMGAVYLKLTVLDGVPIVSF
KEL
IGGAATKKPGQKRRAGAAALGLDFSAMVEIVLALTPRDFHKSMTTHADHRIWQDVYCPVTAMGAVYLKLTVLDGVPIVSF
KEL
Download Length: 252 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14528.70 Da Isoelectric Point: 8.5005
>AT292152 WP_003809516.1 NZ_LS483259:1528397-1528798 [Bordetella pertussis]
MKCPVCGAAALARDTRDVPYSYKGETITIAAVTGDWCPACGENVLDGAESARVSEAMLAFNRLVNARRVDPGFIVRVRRK
LGLDQREAAALFGGGTNAFSRYENGKTRPPLALVKLLRLLDRHPELLEEVRAD
MKCPVCGAAALARDTRDVPYSYKGETITIAAVTGDWCPACGENVLDGAESARVSEAMLAFNRLVNARRVDPGFIVRVRRK
LGLDQREAAALFGGGTNAFSRYENGKTRPPLALVKLLRLLDRHPELLEEVRAD
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|