Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 1527050..1527705 | Replicon | chromosome |
Accession | NZ_LS483258 | ||
Organism | Bordetella pertussis strain BP312 isolate Bordetella pertussis |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | - |
Locus tag | JN418_RS07335 | Protein ID | WP_047122780.1 |
Coordinates | 1527050..1527301 (+) | Length | 84 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | Q7VY40 |
Locus tag | JN418_RS07340 | Protein ID | WP_003809516.1 |
Coordinates | 1527304..1527705 (+) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN418_RS07310 | 1522211..1523341 | - | 1131 | WP_010930401.1 | helix-turn-helix transcriptional regulator | - |
JN418_RS07315 | 1523576..1524157 | + | 582 | WP_019247931.1 | molybdenum cofactor biosysynthesis protein | - |
JN418_RS07320 | 1524294..1525358 | + | 1065 | WP_003809510.1 | fructose-bisphosphate aldolase class II | - |
JN418_RS07325 | 1525443..1525889 | - | 447 | WP_003819827.1 | GFA family protein | - |
JN418_RS07330 | 1526114..1526995 | + | 882 | WP_003809513.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
JN418_RS07335 | 1527050..1527301 | + | 252 | WP_047122780.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
JN418_RS07340 | 1527304..1527705 | + | 402 | WP_003809516.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
JN418_RS07345 | 1527725..1527961 | + | 237 | WP_010930404.1 | membrane protein | - |
JN418_RS07350 | 1527969..1528448 | + | 480 | WP_010930405.1 | disulfide bond formation protein B | - |
JN418_RS07355 | 1528598..1529113 | + | 516 | WP_019247930.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
JN418_RS07360 | 1529116..1530306 | + | 1191 | WP_010930406.1 | 5-(carboxyamino)imidazole ribonucleotide synthase | - |
JN418_RS07365 | 1530326..1531363 | + | 1038 | WP_023853543.1 | threonylcarbamoyl-AMP synthase | - |
JN418_RS07370 | 1531500..1532522 | + | 1023 | WP_003809532.1 | amino acid ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 84 a.a. Molecular weight: 8952.52 Da Isoelectric Point: 9.7242
>T292150 WP_047122780.1 NZ_LS483258:1527050-1527301 [Bordetella pertussis]
IGGAATKKPGQKRRAGAAALGLDFSAMVEIVLALTPRDFHKSMTTHADHRIWQDVYCPVTAMGAVYLKLTVLDGVPIVSF
KEL
IGGAATKKPGQKRRAGAAALGLDFSAMVEIVLALTPRDFHKSMTTHADHRIWQDVYCPVTAMGAVYLKLTVLDGVPIVSF
KEL
Download Length: 252 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14528.70 Da Isoelectric Point: 8.5005
>AT292150 WP_003809516.1 NZ_LS483258:1527304-1527705 [Bordetella pertussis]
MKCPVCGAAALARDTRDVPYSYKGETITIAAVTGDWCPACGENVLDGAESARVSEAMLAFNRLVNARRVDPGFIVRVRRK
LGLDQREAAALFGGGTNAFSRYENGKTRPPLALVKLLRLLDRHPELLEEVRAD
MKCPVCGAAALARDTRDVPYSYKGETITIAAVTGDWCPACGENVLDGAESARVSEAMLAFNRLVNARRVDPGFIVRVRRK
LGLDQREAAALFGGGTNAFSRYENGKTRPPLALVKLLRLLDRHPELLEEVRAD
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|