Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 1581904..1582559 | Replicon | chromosome |
Accession | NZ_LS483257 | ||
Organism | Bordetella pertussis strain BP6384 isolate Bordetella pertussis |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | - |
Locus tag | JMV99_RS07705 | Protein ID | WP_047122780.1 |
Coordinates | 1581904..1582155 (+) | Length | 84 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | Q7VY40 |
Locus tag | JMV99_RS07710 | Protein ID | WP_003809516.1 |
Coordinates | 1582158..1582559 (+) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV99_RS07680 | 1577065..1578195 | - | 1131 | WP_010930401.1 | helix-turn-helix transcriptional regulator | - |
JMV99_RS07685 | 1578430..1579011 | + | 582 | WP_019247931.1 | molybdenum cofactor biosysynthesis protein | - |
JMV99_RS07690 | 1579148..1580212 | + | 1065 | WP_003809510.1 | fructose-bisphosphate aldolase class II | - |
JMV99_RS07695 | 1580297..1580743 | - | 447 | WP_003819827.1 | GFA family protein | - |
JMV99_RS07700 | 1580968..1581849 | + | 882 | WP_003809513.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
JMV99_RS07705 | 1581904..1582155 | + | 252 | WP_047122780.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
JMV99_RS07710 | 1582158..1582559 | + | 402 | WP_003809516.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
JMV99_RS07715 | 1582579..1582815 | + | 237 | WP_010930404.1 | membrane protein | - |
JMV99_RS07720 | 1582823..1583302 | + | 480 | WP_010930405.1 | disulfide bond formation protein B | - |
JMV99_RS07725 | 1583452..1583967 | + | 516 | WP_019247930.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
JMV99_RS07730 | 1583970..1585160 | + | 1191 | WP_010930406.1 | 5-(carboxyamino)imidazole ribonucleotide synthase | - |
JMV99_RS07735 | 1585180..1586217 | + | 1038 | WP_023853543.1 | threonylcarbamoyl-AMP synthase | - |
JMV99_RS07740 | 1586354..1587376 | + | 1023 | WP_003809532.1 | amino acid ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 84 a.a. Molecular weight: 8952.52 Da Isoelectric Point: 9.7242
>T292147 WP_047122780.1 NZ_LS483257:1581904-1582155 [Bordetella pertussis]
IGGAATKKPGQKRRAGAAALGLDFSAMVEIVLALTPRDFHKSMTTHADHRIWQDVYCPVTAMGAVYLKLTVLDGVPIVSF
KEL
IGGAATKKPGQKRRAGAAALGLDFSAMVEIVLALTPRDFHKSMTTHADHRIWQDVYCPVTAMGAVYLKLTVLDGVPIVSF
KEL
Download Length: 252 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14528.70 Da Isoelectric Point: 8.5005
>AT292147 WP_003809516.1 NZ_LS483257:1582158-1582559 [Bordetella pertussis]
MKCPVCGAAALARDTRDVPYSYKGETITIAAVTGDWCPACGENVLDGAESARVSEAMLAFNRLVNARRVDPGFIVRVRRK
LGLDQREAAALFGGGTNAFSRYENGKTRPPLALVKLLRLLDRHPELLEEVRAD
MKCPVCGAAALARDTRDVPYSYKGETITIAAVTGDWCPACGENVLDGAESARVSEAMLAFNRLVNARRVDPGFIVRVRRK
LGLDQREAAALFGGGTNAFSRYENGKTRPPLALVKLLRLLDRHPELLEEVRAD
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|