Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 2526763..2527418 | Replicon | chromosome |
| Accession | NZ_LS483252 | ||
| Organism | Bordetella pertussis strain BP82 isolate Bordetella pertussis | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | - |
| Locus tag | JMW63_RS12100 | Protein ID | WP_047122780.1 |
| Coordinates | 2527167..2527418 (-) | Length | 84 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | Q7VY40 |
| Locus tag | JMW63_RS12095 | Protein ID | WP_003809516.1 |
| Coordinates | 2526763..2527164 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW63_RS12065 | 2521946..2522968 | - | 1023 | WP_003809532.1 | amino acid ABC transporter substrate-binding protein | - |
| JMW63_RS12070 | 2523105..2524142 | - | 1038 | WP_023853543.1 | threonylcarbamoyl-AMP synthase | - |
| JMW63_RS12075 | 2524162..2525352 | - | 1191 | WP_010930406.1 | 5-(carboxyamino)imidazole ribonucleotide synthase | - |
| JMW63_RS12080 | 2525355..2525870 | - | 516 | WP_019247930.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
| JMW63_RS12085 | 2526020..2526499 | - | 480 | WP_010930405.1 | disulfide bond formation protein B | - |
| JMW63_RS12090 | 2526507..2526743 | - | 237 | WP_010930404.1 | membrane protein | - |
| JMW63_RS12095 | 2526763..2527164 | - | 402 | WP_003809516.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
| JMW63_RS12100 | 2527167..2527418 | - | 252 | WP_047122780.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
| JMW63_RS12105 | 2527473..2528354 | - | 882 | WP_003809513.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| JMW63_RS12110 | 2528579..2529025 | + | 447 | WP_003819827.1 | GFA family protein | - |
| JMW63_RS12115 | 2529110..2530174 | - | 1065 | WP_003809510.1 | fructose-bisphosphate aldolase class II | - |
| JMW63_RS12120 | 2530311..2530892 | - | 582 | WP_019247931.1 | molybdenum cofactor biosysynthesis protein | - |
| JMW63_RS12125 | 2531127..2532257 | + | 1131 | WP_010930401.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 84 a.a. Molecular weight: 8952.52 Da Isoelectric Point: 9.7242
>T292139 WP_047122780.1 NZ_LS483252:c2527418-2527167 [Bordetella pertussis]
IGGAATKKPGQKRRAGAAALGLDFSAMVEIVLALTPRDFHKSMTTHADHRIWQDVYCPVTAMGAVYLKLTVLDGVPIVSF
KEL
IGGAATKKPGQKRRAGAAALGLDFSAMVEIVLALTPRDFHKSMTTHADHRIWQDVYCPVTAMGAVYLKLTVLDGVPIVSF
KEL
Download Length: 252 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14528.70 Da Isoelectric Point: 8.5005
>AT292139 WP_003809516.1 NZ_LS483252:c2527164-2526763 [Bordetella pertussis]
MKCPVCGAAALARDTRDVPYSYKGETITIAAVTGDWCPACGENVLDGAESARVSEAMLAFNRLVNARRVDPGFIVRVRRK
LGLDQREAAALFGGGTNAFSRYENGKTRPPLALVKLLRLLDRHPELLEEVRAD
MKCPVCGAAALARDTRDVPYSYKGETITIAAVTGDWCPACGENVLDGAESARVSEAMLAFNRLVNARRVDPGFIVRVRRK
LGLDQREAAALFGGGTNAFSRYENGKTRPPLALVKLLRLLDRHPELLEEVRAD
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|