Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 2526774..2527429 | Replicon | chromosome |
Accession | NZ_LS483251 | ||
Organism | Bordetella pertussis strain BP46 isolate Bordetella pertussis |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | - |
Locus tag | JMW30_RS12165 | Protein ID | WP_047122780.1 |
Coordinates | 2527178..2527429 (-) | Length | 84 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | Q7VY40 |
Locus tag | JMW30_RS12160 | Protein ID | WP_003809516.1 |
Coordinates | 2526774..2527175 (-) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW30_RS12130 | 2521957..2522979 | - | 1023 | WP_003809532.1 | amino acid ABC transporter substrate-binding protein | - |
JMW30_RS12135 | 2523116..2524153 | - | 1038 | WP_023853543.1 | threonylcarbamoyl-AMP synthase | - |
JMW30_RS12140 | 2524173..2525363 | - | 1191 | WP_010930406.1 | 5-(carboxyamino)imidazole ribonucleotide synthase | - |
JMW30_RS12145 | 2525366..2525881 | - | 516 | WP_019247930.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
JMW30_RS12150 | 2526031..2526510 | - | 480 | WP_010930405.1 | disulfide bond formation protein B | - |
JMW30_RS12155 | 2526518..2526754 | - | 237 | WP_010930404.1 | membrane protein | - |
JMW30_RS12160 | 2526774..2527175 | - | 402 | WP_003809516.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
JMW30_RS12165 | 2527178..2527429 | - | 252 | WP_047122780.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
JMW30_RS12170 | 2527484..2528365 | - | 882 | WP_003809513.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
JMW30_RS12175 | 2528590..2529036 | + | 447 | WP_003819827.1 | GFA family protein | - |
JMW30_RS12180 | 2529121..2530185 | - | 1065 | WP_003809510.1 | fructose-bisphosphate aldolase class II | - |
JMW30_RS12185 | 2530322..2530903 | - | 582 | WP_019247931.1 | molybdenum cofactor biosysynthesis protein | - |
JMW30_RS12190 | 2531138..2532268 | + | 1131 | WP_010930401.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 84 a.a. Molecular weight: 8952.52 Da Isoelectric Point: 9.7242
>T292137 WP_047122780.1 NZ_LS483251:c2527429-2527178 [Bordetella pertussis]
IGGAATKKPGQKRRAGAAALGLDFSAMVEIVLALTPRDFHKSMTTHADHRIWQDVYCPVTAMGAVYLKLTVLDGVPIVSF
KEL
IGGAATKKPGQKRRAGAAALGLDFSAMVEIVLALTPRDFHKSMTTHADHRIWQDVYCPVTAMGAVYLKLTVLDGVPIVSF
KEL
Download Length: 252 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14528.70 Da Isoelectric Point: 8.5005
>AT292137 WP_003809516.1 NZ_LS483251:c2527175-2526774 [Bordetella pertussis]
MKCPVCGAAALARDTRDVPYSYKGETITIAAVTGDWCPACGENVLDGAESARVSEAMLAFNRLVNARRVDPGFIVRVRRK
LGLDQREAAALFGGGTNAFSRYENGKTRPPLALVKLLRLLDRHPELLEEVRAD
MKCPVCGAAALARDTRDVPYSYKGETITIAAVTGDWCPACGENVLDGAESARVSEAMLAFNRLVNARRVDPGFIVRVRRK
LGLDQREAAALFGGGTNAFSRYENGKTRPPLALVKLLRLLDRHPELLEEVRAD
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|