Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3757909..3758593 | Replicon | chromosome |
Accession | NZ_LS483250 | ||
Organism | Moritella yayanosii strain DB21MT 5 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | - |
Locus tag | MORIYA_RS17445 | Protein ID | WP_112717219.1 |
Coordinates | 3758180..3758593 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | - |
Locus tag | MORIYA_RS17440 | Protein ID | WP_197713400.1 |
Coordinates | 3757909..3758196 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MORIYA_RS17410 | 3753249..3753698 | + | 450 | WP_112717207.1 | hypothetical protein | - |
MORIYA_RS17415 | 3753717..3754343 | + | 627 | WP_112717209.1 | UbiX family flavin prenyltransferase | - |
MORIYA_RS17420 | 3754347..3754985 | - | 639 | WP_112717211.1 | TetR/AcrR family transcriptional regulator | - |
MORIYA_RS17425 | 3755343..3755876 | + | 534 | WP_112717213.1 | hypoxanthine phosphoribosyltransferase | - |
MORIYA_RS17430 | 3756143..3757069 | + | 927 | WP_112717215.1 | ABC transporter ATP-binding protein | - |
MORIYA_RS17435 | 3757066..3757836 | + | 771 | WP_112717217.1 | ABC transporter permease | - |
MORIYA_RS17440 | 3757909..3758196 | + | 288 | WP_197713400.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
MORIYA_RS17445 | 3758180..3758593 | + | 414 | WP_112717219.1 | type II toxin-antitoxin system YafO family toxin | Toxin |
MORIYA_RS17450 | 3758714..3759415 | + | 702 | WP_112717221.1 | SAM-dependent methyltransferase | - |
MORIYA_RS17455 | 3759513..3760706 | - | 1194 | WP_112717223.1 | LPS O-antigen chain length determinant protein WzzB | - |
MORIYA_RS17460 | 3761244..3762863 | + | 1620 | WP_112714498.1 | IS1634 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15951.24 Da Isoelectric Point: 6.6327
>T292135 WP_112717219.1 NZ_LS483250:3758180-3758593 [Moritella yayanosii]
MNLSNNIRIFKSRPLIESLNESELSSLVSDFKLYKLTGQLPDTFGCDVPYDHPNTMPTLKNEDVRHLHLLDEDMKWQVNK
LQFYKTSDTHLVYCQGGVDENCYLLIAVLSPNAHEQARNNQVMFKIAIMAENFRRKF
MNLSNNIRIFKSRPLIESLNESELSSLVSDFKLYKLTGQLPDTFGCDVPYDHPNTMPTLKNEDVRHLHLLDEDMKWQVNK
LQFYKTSDTHLVYCQGGVDENCYLLIAVLSPNAHEQARNNQVMFKIAIMAENFRRKF
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|