Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1853266..1853996 | Replicon | chromosome |
| Accession | NZ_LS483250 | ||
| Organism | Moritella yayanosii strain DB21MT 5 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | MORIYA_RS08415 | Protein ID | WP_112714327.1 |
| Coordinates | 1853685..1853996 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | MORIYA_RS08410 | Protein ID | WP_197713418.1 |
| Coordinates | 1853266..1853640 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MORIYA_RS08375 | 1849011..1849211 | + | 201 | WP_112714319.1 | EAL domain-containing protein | - |
| MORIYA_RS08380 | 1849215..1849394 | - | 180 | WP_162629204.1 | hypothetical protein | - |
| MORIYA_RS08385 | 1849446..1849985 | - | 540 | Protein_1629 | maltose/maltodextrin ABC transporter substrate-binding protein MalE | - |
| MORIYA_RS08390 | 1850010..1850117 | + | 108 | WP_197713364.1 | transposase | - |
| MORIYA_RS08395 | 1850127..1850588 | + | 462 | Protein_1631 | hypothetical protein | - |
| MORIYA_RS08400 | 1850673..1852583 | - | 1911 | WP_112714323.1 | methyl-accepting chemotaxis protein | - |
| MORIYA_RS08405 | 1852881..1853102 | - | 222 | Protein_1633 | tryptophanase | - |
| MORIYA_RS08410 | 1853266..1853640 | - | 375 | WP_197713418.1 | transcriptional regulator | Antitoxin |
| MORIYA_RS08415 | 1853685..1853996 | - | 312 | WP_112714327.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| MORIYA_RS08420 | 1854069..1854639 | - | 571 | Protein_1636 | hypothetical protein | - |
| MORIYA_RS08425 | 1854818..1855111 | + | 294 | WP_112714329.1 | metalloregulator ArsR/SmtB family transcription factor | - |
| MORIYA_RS08430 | 1855130..1855552 | + | 423 | WP_112714331.1 | YeeE/YedE family protein | - |
| MORIYA_RS08435 | 1855552..1856019 | + | 468 | WP_112714333.1 | YeeE/YedE family protein | - |
| MORIYA_RS08440 | 1856084..1856527 | - | 444 | WP_112714335.1 | Lrp/AsnC family transcriptional regulator | - |
| MORIYA_RS08445 | 1856638..1857225 | + | 588 | WP_112714337.1 | LysE family translocator | - |
| MORIYA_RS08450 | 1857305..1857559 | - | 255 | WP_112714339.1 | hypothetical protein | - |
| MORIYA_RS08455 | 1857679..1857903 | - | 225 | WP_006031345.1 | helix-turn-helix transcriptional regulator | - |
| MORIYA_RS08460 | 1857913..1858461 | - | 549 | WP_112714341.1 | DUF2975 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12108.95 Da Isoelectric Point: 9.7294
>T292134 WP_112714327.1 NZ_LS483250:c1853996-1853685 [Moritella yayanosii]
MHVISRKPFSDAARKYPNDAAAIEALYKSFKSNNFSNPLEMKNVYPSLDNFKYKDKWYVLDIGGNNLRLITFIEFRDNRM
FVKCIVPHAEYDKLCSKYAKESK
MHVISRKPFSDAARKYPNDAAAIEALYKSFKSNNFSNPLEMKNVYPSLDNFKYKDKWYVLDIGGNNLRLITFIEFRDNRM
FVKCIVPHAEYDKLCSKYAKESK
Download Length: 312 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13955.79 Da Isoelectric Point: 4.0828
>AT292134 WP_197713418.1 NZ_LS483250:c1853640-1853266 [Moritella yayanosii]
MASFVGHISTDEEYTDALALMDDLIEEYDVYKSLIEVLAVSIERWEDTADEFAEFNARIESLDDGVATLRVLMDQYQLKA
DDLKDVIGGKSLVSMILNGTRKLTKEHIQAISTKYNISPALFFA
MASFVGHISTDEEYTDALALMDDLIEEYDVYKSLIEVLAVSIERWEDTADEFAEFNARIESLDDGVATLRVLMDQYQLKA
DDLKDVIGGKSLVSMILNGTRKLTKEHIQAISTKYNISPALFFA
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|