Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 1853266..1853996 Replicon chromosome
Accession NZ_LS483250
Organism Moritella yayanosii strain DB21MT 5

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag MORIYA_RS08415 Protein ID WP_112714327.1
Coordinates 1853685..1853996 (-) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag MORIYA_RS08410 Protein ID WP_197713418.1
Coordinates 1853266..1853640 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MORIYA_RS08375 1849011..1849211 + 201 WP_112714319.1 EAL domain-containing protein -
MORIYA_RS08380 1849215..1849394 - 180 WP_162629204.1 hypothetical protein -
MORIYA_RS08385 1849446..1849985 - 540 Protein_1629 maltose/maltodextrin ABC transporter substrate-binding protein MalE -
MORIYA_RS08390 1850010..1850117 + 108 WP_197713364.1 transposase -
MORIYA_RS08395 1850127..1850588 + 462 Protein_1631 hypothetical protein -
MORIYA_RS08400 1850673..1852583 - 1911 WP_112714323.1 methyl-accepting chemotaxis protein -
MORIYA_RS08405 1852881..1853102 - 222 Protein_1633 tryptophanase -
MORIYA_RS08410 1853266..1853640 - 375 WP_197713418.1 transcriptional regulator Antitoxin
MORIYA_RS08415 1853685..1853996 - 312 WP_112714327.1 type II toxin-antitoxin system HigB family toxin Toxin
MORIYA_RS08420 1854069..1854639 - 571 Protein_1636 hypothetical protein -
MORIYA_RS08425 1854818..1855111 + 294 WP_112714329.1 metalloregulator ArsR/SmtB family transcription factor -
MORIYA_RS08430 1855130..1855552 + 423 WP_112714331.1 YeeE/YedE family protein -
MORIYA_RS08435 1855552..1856019 + 468 WP_112714333.1 YeeE/YedE family protein -
MORIYA_RS08440 1856084..1856527 - 444 WP_112714335.1 Lrp/AsnC family transcriptional regulator -
MORIYA_RS08445 1856638..1857225 + 588 WP_112714337.1 LysE family translocator -
MORIYA_RS08450 1857305..1857559 - 255 WP_112714339.1 hypothetical protein -
MORIYA_RS08455 1857679..1857903 - 225 WP_006031345.1 helix-turn-helix transcriptional regulator -
MORIYA_RS08460 1857913..1858461 - 549 WP_112714341.1 DUF2975 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(21-93)

Antitoxin

Antitoxin HigA

(2-123)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12108.95 Da        Isoelectric Point: 9.7294

>T292134 WP_112714327.1 NZ_LS483250:c1853996-1853685 [Moritella yayanosii]
MHVISRKPFSDAARKYPNDAAAIEALYKSFKSNNFSNPLEMKNVYPSLDNFKYKDKWYVLDIGGNNLRLITFIEFRDNRM
FVKCIVPHAEYDKLCSKYAKESK

Download         Length: 312 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13955.79 Da        Isoelectric Point: 4.0828

>AT292134 WP_197713418.1 NZ_LS483250:c1853640-1853266 [Moritella yayanosii]
MASFVGHISTDEEYTDALALMDDLIEEYDVYKSLIEVLAVSIERWEDTADEFAEFNARIESLDDGVATLRVLMDQYQLKA
DDLKDVIGGKSLVSMILNGTRKLTKEHIQAISTKYNISPALFFA

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References