Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/RelE-MqsA
Location 1156087..1156726 Replicon chromosome
Accession NZ_LS483250
Organism Moritella yayanosii strain DB21MT 5

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag MORIYA_RS05185 Protein ID WP_112713275.1
Coordinates 1156388..1156726 (-) Length 113 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag MORIYA_RS05180 Protein ID WP_112713273.1
Coordinates 1156087..1156401 (-) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MORIYA_RS05150 1151110..1151766 - 657 WP_112713267.1 LysE family translocator -
MORIYA_RS20735 1151908..1152084 + 177 WP_162629203.1 hypothetical protein -
MORIYA_RS05155 1152081..1153028 + 948 WP_112713269.1 transposase -
MORIYA_RS05160 1153291..1153572 - 282 WP_112713271.1 hypothetical protein -
MORIYA_RS05165 1153713..1154096 - 384 WP_197713355.1 hypothetical protein -
MORIYA_RS20990 1154417..1154680 - 264 WP_162629228.1 transposase -
MORIYA_RS20995 1154658..1154891 - 234 WP_162629229.1 hypothetical protein -
MORIYA_RS20750 1155102..1155263 - 162 WP_162629230.1 hypothetical protein -
MORIYA_RS05175 1155688..1156063 + 376 Protein_1007 transposase -
MORIYA_RS05180 1156087..1156401 - 315 WP_112713273.1 type II toxin-antitoxin system MqsA family antitoxin Antitoxin
MORIYA_RS05185 1156388..1156726 - 339 WP_112713275.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
MORIYA_RS05190 1156884..1157180 - 297 WP_112713277.1 HigA family addiction module antidote protein -
MORIYA_RS05195 1157180..1157458 - 279 WP_112713279.1 type II toxin-antitoxin system RelE/ParE family toxin -
MORIYA_RS05200 1157617..1157910 - 294 WP_112713281.1 HigA family addiction module antidote protein -
MORIYA_RS05205 1158022..1159614 - 1593 WP_112713283.1 transposase -
MORIYA_RS05210 1159736..1160059 - 324 WP_112713285.1 IS66 family insertion sequence element accessory protein TnpB -
MORIYA_RS05215 1160056..1160421 - 366 WP_112713287.1 hypothetical protein -
MORIYA_RS05220 1160496..1160750 - 255 WP_112713289.1 type II toxin-antitoxin system RelE/ParE family toxin -
MORIYA_RS05225 1161025..1161411 - 387 WP_112713291.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1149317..1157910 8593


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-2

(8-105)

Antitoxin

Cro/C1-type helix-turn-helix domain

(43-92)


Sequences

Toxin        


Download         Length: 113 a.a.        Molecular weight: 13092.09 Da        Isoelectric Point: 10.1026

>T292132 WP_112713275.1 NZ_LS483250:c1156726-1156388 [Moritella yayanosii]
MKCIFVESKIFEKYRDDHLNDEEFRLFQTELMSNPKKGDVIQGTGGLRKVRVASKGKGKGKRGGSRVIYYFLDEKRRCYL
LTIYGKSEVSDLTADQKKQLKAFMEVWRNEQS

Download         Length: 339 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 11715.20 Da        Isoelectric Point: 6.4896

>AT292132 WP_112713273.1 NZ_LS483250:c1156401-1156087 [Moritella yayanosii]
MSNRDLFTELSSALVEAKEHSEGKLTLKTHHVNDVSELDISPNEIVNIREKFNMSRGVFASLLHTSSRTLENWEQGRSAP
NGQAITLLKLVQRHPETLTHIAEL

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References