Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
| Location | 1156087..1156726 | Replicon | chromosome |
| Accession | NZ_LS483250 | ||
| Organism | Moritella yayanosii strain DB21MT 5 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | MORIYA_RS05185 | Protein ID | WP_112713275.1 |
| Coordinates | 1156388..1156726 (-) | Length | 113 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | MORIYA_RS05180 | Protein ID | WP_112713273.1 |
| Coordinates | 1156087..1156401 (-) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MORIYA_RS05150 | 1151110..1151766 | - | 657 | WP_112713267.1 | LysE family translocator | - |
| MORIYA_RS20735 | 1151908..1152084 | + | 177 | WP_162629203.1 | hypothetical protein | - |
| MORIYA_RS05155 | 1152081..1153028 | + | 948 | WP_112713269.1 | transposase | - |
| MORIYA_RS05160 | 1153291..1153572 | - | 282 | WP_112713271.1 | hypothetical protein | - |
| MORIYA_RS05165 | 1153713..1154096 | - | 384 | WP_197713355.1 | hypothetical protein | - |
| MORIYA_RS20990 | 1154417..1154680 | - | 264 | WP_162629228.1 | transposase | - |
| MORIYA_RS20995 | 1154658..1154891 | - | 234 | WP_162629229.1 | hypothetical protein | - |
| MORIYA_RS20750 | 1155102..1155263 | - | 162 | WP_162629230.1 | hypothetical protein | - |
| MORIYA_RS05175 | 1155688..1156063 | + | 376 | Protein_1007 | transposase | - |
| MORIYA_RS05180 | 1156087..1156401 | - | 315 | WP_112713273.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
| MORIYA_RS05185 | 1156388..1156726 | - | 339 | WP_112713275.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| MORIYA_RS05190 | 1156884..1157180 | - | 297 | WP_112713277.1 | HigA family addiction module antidote protein | - |
| MORIYA_RS05195 | 1157180..1157458 | - | 279 | WP_112713279.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| MORIYA_RS05200 | 1157617..1157910 | - | 294 | WP_112713281.1 | HigA family addiction module antidote protein | - |
| MORIYA_RS05205 | 1158022..1159614 | - | 1593 | WP_112713283.1 | transposase | - |
| MORIYA_RS05210 | 1159736..1160059 | - | 324 | WP_112713285.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| MORIYA_RS05215 | 1160056..1160421 | - | 366 | WP_112713287.1 | hypothetical protein | - |
| MORIYA_RS05220 | 1160496..1160750 | - | 255 | WP_112713289.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| MORIYA_RS05225 | 1161025..1161411 | - | 387 | WP_112713291.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1149317..1157910 | 8593 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 13092.09 Da Isoelectric Point: 10.1026
>T292132 WP_112713275.1 NZ_LS483250:c1156726-1156388 [Moritella yayanosii]
MKCIFVESKIFEKYRDDHLNDEEFRLFQTELMSNPKKGDVIQGTGGLRKVRVASKGKGKGKRGGSRVIYYFLDEKRRCYL
LTIYGKSEVSDLTADQKKQLKAFMEVWRNEQS
MKCIFVESKIFEKYRDDHLNDEEFRLFQTELMSNPKKGDVIQGTGGLRKVRVASKGKGKGKRGGSRVIYYFLDEKRRCYL
LTIYGKSEVSDLTADQKKQLKAFMEVWRNEQS
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|