Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1834880..1835060 | Replicon | chromosome |
| Accession | NC_020566 | ||
| Organism | Staphylococcus aureus subsp. aureus ST228 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | SAI5S5_RS14880 | Protein ID | WP_001801861.1 |
| Coordinates | 1834880..1834975 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1835003..1835060 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAI5S5_RS08860 | 1830043..1830693 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
| SAI5S5_RS08865 | 1830774..1831769 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| SAI5S5_RS08870 | 1831844..1832470 | + | 627 | WP_000669024.1 | hypothetical protein | - |
| SAI5S5_RS08875 | 1832511..1832852 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| SAI5S5_RS08880 | 1832953..1833525 | + | 573 | WP_000414216.1 | hypothetical protein | - |
| SAI5S5_RS14535 | 1833723..1834735 | - | 1013 | Protein_1702 | IS3 family transposase | - |
| SAI5S5_RS14880 | 1834880..1834975 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1835003..1835060 | - | 58 | - | - | Antitoxin |
| SAI5S5_RS08900 | 1835098..1835199 | + | 102 | WP_001792025.1 | hypothetical protein | - |
| SAI5S5_RS14885 | 1835177..1835338 | - | 162 | Protein_1705 | transposase | - |
| SAI5S5_RS08905 | 1835329..1835823 | - | 495 | Protein_1706 | transposase | - |
| SAI5S5_RS08910 | 1836275..1837503 | - | 1229 | Protein_1707 | restriction endonuclease subunit S | - |
| SAI5S5_RS08915 | 1837496..1839051 | - | 1556 | Protein_1708 | type I restriction-modification system subunit M | - |
| SAI5S5_RS08920 | 1839215..1839349 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA / selk | 1810737..1861884 | 51147 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T29213 WP_001801861.1 NC_020566:1834880-1834975 [Staphylococcus aureus subsp. aureus ST228]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T29213 NC_020566:1834880-1834975 [Staphylococcus aureus subsp. aureus ST228]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT29213 NC_020566:c1835060-1835003 [Staphylococcus aureus subsp. aureus ST228]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|