Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 2816616..2817256 | Replicon | chromosome |
| Accession | NZ_LS399318 | ||
| Organism | Klebsiella pneumoniae isolate CNR48 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | W9BBY1 |
| Locus tag | CNR480_RS13445 | Protein ID | WP_016529833.1 |
| Coordinates | 2816616..2816963 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | CNR480_RS13450 | Protein ID | WP_040181955.1 |
| Coordinates | 2816963..2817256 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CNR480_RS13435 | 2812542..2813975 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
| CNR480_RS13440 | 2813993..2816440 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
| CNR480_RS13445 | 2816616..2816963 | + | 348 | WP_016529833.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| CNR480_RS13450 | 2816963..2817256 | + | 294 | WP_040181955.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| CNR480_RS13455 | 2817326..2818834 | - | 1509 | WP_023301456.1 | glycerol-3-phosphate dehydrogenase | - |
| CNR480_RS13460 | 2819039..2819368 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
| CNR480_RS13465 | 2819419..2820249 | + | 831 | WP_024622927.1 | rhomboid family intramembrane serine protease GlpG | - |
| CNR480_RS13470 | 2820299..2821057 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13549.56 Da Isoelectric Point: 5.6749
>T292122 WP_016529833.1 NZ_LS399318:2816616-2816963 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|