Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 2790427..2791013 | Replicon | chromosome |
| Accession | NZ_LS399318 | ||
| Organism | Klebsiella pneumoniae isolate CNR48 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | CNR480_RS13335 | Protein ID | WP_023285605.1 |
| Coordinates | 2790645..2791013 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | W9B1V1 |
| Locus tag | CNR480_RS13330 | Protein ID | WP_004174006.1 |
| Coordinates | 2790427..2790648 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CNR480_RS13310 | 2786584..2787510 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| CNR480_RS13315 | 2787507..2788784 | + | 1278 | WP_004174005.1 | branched chain amino acid ABC transporter permease LivM | - |
| CNR480_RS13320 | 2788781..2789548 | + | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| CNR480_RS13325 | 2789550..2790263 | + | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| CNR480_RS13330 | 2790427..2790648 | + | 222 | WP_004174006.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| CNR480_RS13335 | 2790645..2791013 | + | 369 | WP_023285605.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| CNR480_RS13340 | 2791286..2792602 | + | 1317 | WP_002920796.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| CNR480_RS13345 | 2792709..2793596 | + | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| CNR480_RS13350 | 2793593..2794438 | + | 846 | WP_004145129.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| CNR480_RS13355 | 2794440..2795510 | + | 1071 | WP_004150074.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 2787507..2796247 | 8740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13534.89 Da Isoelectric Point: 8.6410
>T292121 WP_023285605.1 NZ_LS399318:2790645-2791013 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGITVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGITVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|