Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 2790427..2791013 Replicon chromosome
Accession NZ_LS399318
Organism Klebsiella pneumoniae isolate CNR48

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag CNR480_RS13335 Protein ID WP_023285605.1
Coordinates 2790645..2791013 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag CNR480_RS13330 Protein ID WP_004174006.1
Coordinates 2790427..2790648 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CNR480_RS13310 2786584..2787510 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
CNR480_RS13315 2787507..2788784 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
CNR480_RS13320 2788781..2789548 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
CNR480_RS13325 2789550..2790263 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
CNR480_RS13330 2790427..2790648 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
CNR480_RS13335 2790645..2791013 + 369 WP_023285605.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
CNR480_RS13340 2791286..2792602 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
CNR480_RS13345 2792709..2793596 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
CNR480_RS13350 2793593..2794438 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
CNR480_RS13355 2794440..2795510 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2787507..2796247 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13534.89 Da        Isoelectric Point: 8.6410

>T292121 WP_023285605.1 NZ_LS399318:2790645-2791013 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGITVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT292121 WP_004174006.1 NZ_LS399318:2790427-2790648 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References