Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 1585146..1585801 | Replicon | chromosome |
Accession | NZ_LS398588 | ||
Organism | Bordetella pertussis strain VS67 isolate Bordetella pertussis |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | - |
Locus tag | EAO51_RS07750 | Protein ID | WP_047122780.1 |
Coordinates | 1585146..1585397 (+) | Length | 84 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | Q7VY40 |
Locus tag | EAO51_RS07755 | Protein ID | WP_003809516.1 |
Coordinates | 1585400..1585801 (+) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EAO51_RS07725 | 1580307..1581437 | - | 1131 | WP_010930401.1 | helix-turn-helix transcriptional regulator | - |
EAO51_RS07730 | 1581672..1582253 | + | 582 | WP_019247931.1 | molybdenum cofactor biosysynthesis protein | - |
EAO51_RS07735 | 1582390..1583454 | + | 1065 | WP_003809510.1 | fructose-bisphosphate aldolase class II | - |
EAO51_RS07740 | 1583539..1583985 | - | 447 | WP_003819827.1 | GFA family protein | - |
EAO51_RS07745 | 1584210..1585091 | + | 882 | WP_003809513.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
EAO51_RS07750 | 1585146..1585397 | + | 252 | WP_047122780.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
EAO51_RS07755 | 1585400..1585801 | + | 402 | WP_003809516.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
EAO51_RS07760 | 1585821..1586057 | + | 237 | WP_010930404.1 | membrane protein | - |
EAO51_RS07765 | 1586065..1586544 | + | 480 | WP_010930405.1 | disulfide bond formation protein B | - |
EAO51_RS07770 | 1586694..1587209 | + | 516 | WP_019247930.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
EAO51_RS07775 | 1587212..1588402 | + | 1191 | WP_010930406.1 | 5-(carboxyamino)imidazole ribonucleotide synthase | - |
EAO51_RS07780 | 1588422..1589459 | + | 1038 | WP_023853543.1 | threonylcarbamoyl-AMP synthase | - |
EAO51_RS07785 | 1589596..1590618 | + | 1023 | WP_003809532.1 | amino acid ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 84 a.a. Molecular weight: 8952.52 Da Isoelectric Point: 9.7242
>T292106 WP_047122780.1 NZ_LS398588:1585146-1585397 [Bordetella pertussis]
IGGAATKKPGQKRRAGAAALGLDFSAMVEIVLALTPRDFHKSMTTHADHRIWQDVYCPVTAMGAVYLKLTVLDGVPIVSF
KEL
IGGAATKKPGQKRRAGAAALGLDFSAMVEIVLALTPRDFHKSMTTHADHRIWQDVYCPVTAMGAVYLKLTVLDGVPIVSF
KEL
Download Length: 252 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14528.70 Da Isoelectric Point: 8.5005
>AT292106 WP_003809516.1 NZ_LS398588:1585400-1585801 [Bordetella pertussis]
MKCPVCGAAALARDTRDVPYSYKGETITIAAVTGDWCPACGENVLDGAESARVSEAMLAFNRLVNARRVDPGFIVRVRRK
LGLDQREAAALFGGGTNAFSRYENGKTRPPLALVKLLRLLDRHPELLEEVRAD
MKCPVCGAAALARDTRDVPYSYKGETITIAAVTGDWCPACGENVLDGAESARVSEAMLAFNRLVNARRVDPGFIVRVRRK
LGLDQREAAALFGGGTNAFSRYENGKTRPPLALVKLLRLLDRHPELLEEVRAD
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|