292096

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/Txe-RelB
Location 2451734..2452257 Replicon chromosome
Accession NZ_LR962863
Organism Staphylococcus schleiferi strain NCTC12218

Toxin (Protein)


Gene name yoeB Uniprot ID S2XCX2
Locus tag JM183_RS11755 Protein ID WP_016425657.1
Coordinates 2451991..2452257 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID S2XXM7
Locus tag JM183_RS11750 Protein ID WP_016425656.1
Coordinates 2451734..2451991 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JM183_RS11700 (NCTC12218_02473) 2446771..2446956 + 186 WP_016425649.1 hypothetical protein -
JM183_RS11705 (NCTC12218_02474) 2446966..2447418 + 453 WP_016425650.1 DUF523 domain-containing protein -
JM183_RS11710 2447633..2447857 - 225 WP_167512896.1 hypothetical protein -
JM183_RS11715 2447872..2448033 + 162 WP_228446226.1 hypothetical protein -
JM183_RS11720 2448153..2448365 + 213 WP_231371820.1 hypothetical protein -
JM183_RS11725 (NCTC12218_02476) 2448470..2448805 + 336 WP_257211757.1 Msa family membrane protein -
JM183_RS11730 (NCTC12218_02477) 2448780..2449667 + 888 WP_126496490.1 ABC transporter ATP-binding protein -
JM183_RS11735 (NCTC12218_02478) 2449660..2450415 + 756 WP_016425653.1 hypothetical protein -
JM183_RS11740 (NCTC12218_02479) 2450425..2450601 + 177 WP_016425654.1 hypothetical protein -
JM183_RS11745 (NCTC12218_02480) 2450668..2451501 + 834 WP_016425655.1 CPBP family intramembrane metalloprotease -
JM183_RS11750 (NCTC12218_02481) 2451734..2451991 + 258 WP_016425656.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JM183_RS11755 (NCTC12218_02482) 2451991..2452257 + 267 WP_016425657.1 Txe/YoeB family addiction module toxin Toxin
JM183_RS11760 (NCTC12218_02483) 2452697..2453410 - 714 WP_228446227.1 ISL3 family transposase -
JM183_RS11765 (NCTC12218_02484) 2453407..2454015 - 609 WP_236744715.1 transposase family protein -
JM183_RS11770 (NCTC12218_02485) 2454355..2454840 + 486 WP_236744716.1 4'-phosphopantetheinyl transferase superfamily protein -
JM183_RS11775 (NCTC12218_02486) 2454846..2455346 + 501 WP_016425661.1 MepB family protein -
JM183_RS11780 (NCTC12218_02487) 2455491..2455853 + 363 WP_016425662.1 transposase -
JM183_RS11785 (NCTC12218_02489) 2456057..2456725 - 669 WP_016425664.1 saccharopine dehydrogenase NADP-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(24-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-68)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10646.09 Da        Isoelectric Point: 9.7537

>T292096 WP_016425657.1 NZ_LR962863:2451991-2452257 [Staphylococcus schleiferi]
MSYYSVLIKNSAKSDLKKINKSHLKEQFLNVVETLKIDPYEPSQSFEKLQPKHLGRYSRRINHQHRVVYTVDDEKREVYI
FSTWSHYE

Download         Length: 267 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9781.91 Da        Isoelectric Point: 5.1133

>AT292096 WP_016425656.1 NZ_LR962863:2451734-2451991 [Staphylococcus schleiferi]
MNIKTPTNARKEFYELLKHVNVNHEPVIISGSKSENNAVIVSQKDWNSIQETLFLESTGTMDKVRKREKDDSGYTNIEDL
DWGNL

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S2XCX2

Antitoxin

Source ID Structure
AlphaFold DB S2XXM7

References