Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 4101346..4102040 | Replicon | chromosome |
| Accession | NZ_LR898874 | ||
| Organism | Escherichia coli isolate MSB1_4I-sc-2280412 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q0T7Q5 |
| Locus tag | JMX41_RS20505 | Protein ID | WP_001263491.1 |
| Coordinates | 4101346..4101744 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | L4JHF0 |
| Locus tag | JMX41_RS20510 | Protein ID | WP_000554755.1 |
| Coordinates | 4101747..4102040 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX41_RS20480 | 4096713..4097171 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| JMX41_RS20485 | 4097432..4098889 | + | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
| JMX41_RS20490 | 4098946..4099560 | - | 615 | WP_000602125.1 | peptide chain release factor H | - |
| JMX41_RS20495 | 4099557..4100693 | - | 1137 | WP_021563227.1 | RNA ligase RtcB family protein | - |
| JMX41_RS20500 | 4100884..4101336 | - | 453 | WP_001059882.1 | GNAT family N-acetyltransferase | - |
| JMX41_RS20505 | 4101346..4101744 | - | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| JMX41_RS20510 | 4101747..4102040 | - | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| JMX41_RS20515 | 4102092..4103147 | - | 1056 | WP_001226154.1 | DNA polymerase IV | - |
| JMX41_RS20520 | 4103218..4104141 | - | 924 | WP_001570971.1 | putative lateral flagellar export/assembly protein LafU | - |
| JMX41_RS20525 | 4104144..4105007 | - | 864 | WP_001169516.1 | flagellar motor stator protein MotA | - |
| JMX41_RS20530 | 4105020..4105739 | - | 720 | WP_000938736.1 | FliA/WhiG family RNA polymerase sigma factor | - |
| JMX41_RS20535 | 4105759..4106226 | - | 468 | WP_000725257.1 | flagellar basal body-associated FliL family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | yagV/ecpE / yagW/ecpD / yagX/ecpC | 4052229..4103147 | 50918 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T292079 WP_001263491.1 NZ_LR898874:c4101744-4101346 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TPK7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829G9H5 |