Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 4101346..4102040 Replicon chromosome
Accession NZ_LR898874
Organism Escherichia coli isolate MSB1_4I-sc-2280412

Toxin (Protein)


Gene name yafO Uniprot ID Q0T7Q5
Locus tag JMX41_RS20505 Protein ID WP_001263491.1
Coordinates 4101346..4101744 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag JMX41_RS20510 Protein ID WP_000554755.1
Coordinates 4101747..4102040 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX41_RS20480 4096713..4097171 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
JMX41_RS20485 4097432..4098889 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
JMX41_RS20490 4098946..4099560 - 615 WP_000602125.1 peptide chain release factor H -
JMX41_RS20495 4099557..4100693 - 1137 WP_021563227.1 RNA ligase RtcB family protein -
JMX41_RS20500 4100884..4101336 - 453 WP_001059882.1 GNAT family N-acetyltransferase -
JMX41_RS20505 4101346..4101744 - 399 WP_001263491.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
JMX41_RS20510 4101747..4102040 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
JMX41_RS20515 4102092..4103147 - 1056 WP_001226154.1 DNA polymerase IV -
JMX41_RS20520 4103218..4104141 - 924 WP_001570971.1 putative lateral flagellar export/assembly protein LafU -
JMX41_RS20525 4104144..4105007 - 864 WP_001169516.1 flagellar motor stator protein MotA -
JMX41_RS20530 4105020..4105739 - 720 WP_000938736.1 FliA/WhiG family RNA polymerase sigma factor -
JMX41_RS20535 4105759..4106226 - 468 WP_000725257.1 flagellar basal body-associated FliL family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - yagV/ecpE / yagW/ecpD / yagX/ecpC 4052229..4103147 50918


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15457.86 Da        Isoelectric Point: 8.0949

>T292079 WP_001263491.1 NZ_LR898874:c4101744-4101346 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT292079 WP_000554755.1 NZ_LR898874:c4102040-4101747 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TPK7

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References