Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 3204040..3204808 | Replicon | chromosome |
Accession | NZ_LR898874 | ||
Organism | Escherichia coli isolate MSB1_4I-sc-2280412 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | S1P968 |
Locus tag | JMX41_RS16015 | Protein ID | WP_000854814.1 |
Coordinates | 3204434..3204808 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | JMX41_RS16010 | Protein ID | WP_128857213.1 |
Coordinates | 3204040..3204345 (+) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX41_RS15980 | 3199351..3199896 | - | 546 | WP_000973199.1 | bifunctional adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase | - |
JMX41_RS15985 | 3200361..3200525 | - | 165 | WP_001128468.1 | hypothetical protein | - |
JMX41_RS15990 | 3201473..3202650 | + | 1178 | WP_152895938.1 | IS3 family transposase | - |
JMX41_RS15995 | 3202663..3203127 | + | 465 | WP_001571600.1 | antirestriction protein | - |
JMX41_RS16000 | 3203143..3203619 | + | 477 | WP_001186773.1 | RadC family protein | - |
JMX41_RS16005 | 3203682..3203903 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
JMX41_RS16010 | 3204040..3204345 | + | 306 | WP_128857213.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
JMX41_RS16015 | 3204434..3204808 | + | 375 | WP_000854814.1 | type IV toxin-antitoxin system toxin CbtA | Toxin |
JMX41_RS16020 | 3204805..3204999 | + | 195 | WP_000988601.1 | hypothetical protein | - |
JMX41_RS16025 | 3205012..3205125 | + | 114 | WP_001161660.1 | DUF957 domain-containing protein | - |
JMX41_RS16030 | 3205414..3205560 | - | 147 | Protein_3146 | transposase domain-containing protein | - |
JMX41_RS16035 | 3205614..3205796 | + | 183 | WP_001016348.1 | hypothetical protein | - |
JMX41_RS16040 | 3205897..3206226 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
JMX41_RS16045 | 3206398..3207456 | - | 1059 | WP_001200894.1 | FUSC family protein | - |
JMX41_RS16050 | 3207654..3208127 | - | 474 | WP_201555475.1 | DNA gyrase inhibitor SbmC | - |
JMX41_RS16055 | 3208184..3209404 | - | 1221 | WP_000343765.1 | ISL3-like element ISEc53 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 3208184..3209404 | 1220 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T292074 WP_000854814.1 NZ_LR898874:3204434-3204808 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|