Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 2408802..2409173 | Replicon | chromosome |
| Accession | NZ_LR898874 | ||
| Organism | Escherichia coli isolate MSB1_4I-sc-2280412 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | A0A1Y2ZGM7 |
| Locus tag | JMX41_RS11765 | Protein ID | WP_042038331.1 |
| Coordinates | 2408979..2409173 (-) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 2408802..2408980 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX41_RS11740 | 2404759..2406132 | + | 1374 | WP_000123722.1 | ATP-dependent RNA helicase DbpA | - |
| JMX41_RS11745 | 2406261..2407196 | - | 936 | WP_001157407.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| JMX41_RS11750 | 2407248..2408481 | - | 1234 | Protein_2303 | site-specific integrase | - |
| JMX41_RS11755 | 2408483..2408698 | - | 216 | WP_000079604.1 | excisionase XisR | - |
| JMX41_RS11760 | 2408798..2408986 | - | 189 | WP_001302840.1 | DUF1187 family protein | - |
| - | 2408802..2408980 | + | 179 | NuclAT_0 | - | Antitoxin |
| - | 2408802..2408980 | + | 179 | NuclAT_0 | - | Antitoxin |
| - | 2408802..2408980 | + | 179 | NuclAT_0 | - | Antitoxin |
| - | 2408802..2408980 | + | 179 | NuclAT_0 | - | Antitoxin |
| JMX41_RS11765 | 2408979..2409173 | - | 195 | WP_042038331.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| JMX41_RS11770 | 2409230..2410039 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
| JMX41_RS11775 | 2410032..2412632 | - | 2601 | WP_000105133.1 | exodeoxyribonuclease VIII | - |
| JMX41_RS11780 | 2412734..2413009 | - | 276 | WP_000632297.1 | protein RacC | - |
| JMX41_RS11785 | 2413084..2413254 | - | 171 | WP_001485242.1 | hypothetical protein | - |
| JMX41_RS11790 | 2413254..2413475 | - | 222 | WP_000560223.1 | killing protein KilR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2407248..2417188 | 9940 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7046.94 Da Isoelectric Point: 8.9538
>T292065 WP_042038331.1 NZ_LR898874:c2409173-2408979 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKVISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKVISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT292065 NZ_LR898874:2408802-2408980 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|