Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2238324..2238545 Replicon chromosome
Accession NZ_LR898874
Organism Escherichia coli isolate MSB1_4I-sc-2280412

Toxin (Protein)


Gene name ldrD Uniprot ID L4JC91
Locus tag JMX41_RS10870 Protein ID WP_000170956.1
Coordinates 2238324..2238431 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2238479..2238545 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX41_RS10845 2234169..2235251 + 1083 WP_000804726.1 peptide chain release factor 1 -
JMX41_RS10850 2235251..2236084 + 834 WP_000456472.1 peptide chain release factor N(5)-glutamine methyltransferase -
JMX41_RS10855 2236081..2236473 + 393 WP_000200378.1 invasion regulator SirB2 -
JMX41_RS10860 2236477..2237286 + 810 WP_001257044.1 invasion regulator SirB1 -
JMX41_RS10865 2237322..2238176 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
JMX41_RS10870 2238324..2238431 - 108 WP_000170956.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2238479..2238545 + 67 NuclAT_20 - Antitoxin
- 2238479..2238545 + 67 NuclAT_20 - Antitoxin
- 2238479..2238545 + 67 NuclAT_20 - Antitoxin
- 2238479..2238545 + 67 NuclAT_20 - Antitoxin
- 2238479..2238545 + 67 NuclAT_27 - Antitoxin
- 2238479..2238545 + 67 NuclAT_27 - Antitoxin
- 2238479..2238545 + 67 NuclAT_27 - Antitoxin
- 2238479..2238545 + 67 NuclAT_27 - Antitoxin
- 2238479..2238545 + 67 NuclAT_34 - Antitoxin
- 2238479..2238545 + 67 NuclAT_34 - Antitoxin
- 2238479..2238545 + 67 NuclAT_34 - Antitoxin
- 2238479..2238545 + 67 NuclAT_34 - Antitoxin
- 2238479..2238545 + 67 NuclAT_41 - Antitoxin
- 2238479..2238545 + 67 NuclAT_41 - Antitoxin
- 2238479..2238545 + 67 NuclAT_41 - Antitoxin
- 2238479..2238545 + 67 NuclAT_41 - Antitoxin
- 2238479..2238545 + 67 NuclAT_43 - Antitoxin
- 2238479..2238545 + 67 NuclAT_43 - Antitoxin
- 2238479..2238545 + 67 NuclAT_43 - Antitoxin
- 2238479..2238545 + 67 NuclAT_43 - Antitoxin
- 2238479..2238545 + 67 NuclAT_50 - Antitoxin
- 2238479..2238545 + 67 NuclAT_50 - Antitoxin
- 2238479..2238545 + 67 NuclAT_50 - Antitoxin
- 2238479..2238545 + 67 NuclAT_50 - Antitoxin
- 2238483..2238544 + 62 NuclAT_53 - -
- 2238483..2238544 + 62 NuclAT_53 - -
- 2238483..2238544 + 62 NuclAT_53 - -
- 2238483..2238544 + 62 NuclAT_53 - -
- 2238483..2238544 + 62 NuclAT_55 - -
- 2238483..2238544 + 62 NuclAT_55 - -
- 2238483..2238544 + 62 NuclAT_55 - -
- 2238483..2238544 + 62 NuclAT_55 - -
- 2238483..2238544 + 62 NuclAT_57 - -
- 2238483..2238544 + 62 NuclAT_57 - -
- 2238483..2238544 + 62 NuclAT_57 - -
- 2238483..2238544 + 62 NuclAT_57 - -
- 2238483..2238544 + 62 NuclAT_59 - -
- 2238483..2238544 + 62 NuclAT_59 - -
- 2238483..2238544 + 62 NuclAT_59 - -
- 2238483..2238544 + 62 NuclAT_59 - -
JMX41_RS10875 2238859..2238966 - 108 WP_000170956.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2239019..2239080 + 62 NuclAT_52 - -
- 2239019..2239080 + 62 NuclAT_52 - -
- 2239019..2239080 + 62 NuclAT_52 - -
- 2239019..2239080 + 62 NuclAT_52 - -
- 2239019..2239080 + 62 NuclAT_54 - -
- 2239019..2239080 + 62 NuclAT_54 - -
- 2239019..2239080 + 62 NuclAT_54 - -
- 2239019..2239080 + 62 NuclAT_54 - -
- 2239019..2239080 + 62 NuclAT_56 - -
- 2239019..2239080 + 62 NuclAT_56 - -
- 2239019..2239080 + 62 NuclAT_56 - -
- 2239019..2239080 + 62 NuclAT_56 - -
- 2239019..2239080 + 62 NuclAT_58 - -
- 2239019..2239080 + 62 NuclAT_58 - -
- 2239019..2239080 + 62 NuclAT_58 - -
- 2239019..2239080 + 62 NuclAT_58 - -
- 2239019..2239081 + 63 NuclAT_21 - -
- 2239019..2239081 + 63 NuclAT_21 - -
- 2239019..2239081 + 63 NuclAT_21 - -
- 2239019..2239081 + 63 NuclAT_21 - -
- 2239019..2239081 + 63 NuclAT_28 - -
- 2239019..2239081 + 63 NuclAT_28 - -
- 2239019..2239081 + 63 NuclAT_28 - -
- 2239019..2239081 + 63 NuclAT_28 - -
- 2239019..2239081 + 63 NuclAT_35 - -
- 2239019..2239081 + 63 NuclAT_35 - -
- 2239019..2239081 + 63 NuclAT_35 - -
- 2239019..2239081 + 63 NuclAT_35 - -
- 2239019..2239081 + 63 NuclAT_42 - -
- 2239019..2239081 + 63 NuclAT_42 - -
- 2239019..2239081 + 63 NuclAT_42 - -
- 2239019..2239081 + 63 NuclAT_42 - -
- 2239019..2239081 + 63 NuclAT_44 - -
- 2239019..2239081 + 63 NuclAT_44 - -
- 2239019..2239081 + 63 NuclAT_44 - -
- 2239019..2239081 + 63 NuclAT_44 - -
- 2239019..2239081 + 63 NuclAT_51 - -
- 2239019..2239081 + 63 NuclAT_51 - -
- 2239019..2239081 + 63 NuclAT_51 - -
- 2239019..2239081 + 63 NuclAT_51 - -
JMX41_RS10880 2239372..2240472 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
JMX41_RS10885 2240742..2240972 + 231 WP_001146444.1 putative cation transport regulator ChaB -
JMX41_RS10890 2241130..2241825 + 696 WP_012311798.1 glutathione-specific gamma-glutamylcyclotransferase -
JMX41_RS10895 2241869..2242222 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4041.88 Da        Isoelectric Point: 11.4779

>T292061 WP_000170956.1 NZ_LR898874:c2238431-2238324 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT292061 NZ_LR898874:2238479-2238545 [Escherichia coli]
GTTGTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G035

Antitoxin

Download structure file

References