Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 644473..645272 | Replicon | chromosome |
| Accession | NZ_LR898874 | ||
| Organism | Escherichia coli isolate MSB1_4I-sc-2280412 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V0SSH7 |
| Locus tag | JMX41_RS03140 | Protein ID | WP_000347273.1 |
| Coordinates | 644473..644937 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | A0A210GLR0 |
| Locus tag | JMX41_RS03145 | Protein ID | WP_001571956.1 |
| Coordinates | 644937..645272 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX41_RS03110 | 639474..639908 | - | 435 | WP_000948834.1 | PTS sugar transporter subunit IIA | - |
| JMX41_RS03115 | 639926..640804 | - | 879 | WP_001330129.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| JMX41_RS03120 | 640794..641573 | - | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
| JMX41_RS03125 | 641584..642057 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| JMX41_RS03130 | 642080..643360 | - | 1281 | WP_000681958.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| JMX41_RS03135 | 643609..644418 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| JMX41_RS03140 | 644473..644937 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| JMX41_RS03145 | 644937..645272 | - | 336 | WP_001571956.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| JMX41_RS03150 | 645421..646992 | - | 1572 | WP_001571955.1 | galactarate dehydratase | - |
| JMX41_RS03155 | 647367..648701 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
| JMX41_RS03160 | 648717..649487 | + | 771 | WP_001058217.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T292056 WP_000347273.1 NZ_LR898874:c644937-644473 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SSH7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A210GLR0 |