Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3578778..3579472 Replicon chromosome
Accession NZ_LR898868
Organism Escherichia coli isolate MSB1_1D-sc-2280324

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag JMX26_RS17330 Protein ID WP_001263493.1
Coordinates 3578778..3579176 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag JMX26_RS17335 Protein ID WP_000554757.1
Coordinates 3579179..3579472 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX26_RS17300 3573778..3575022 - 1245 WP_000189541.1 esterase FrsA -
- 3574438..3574518 - 81 NuclAT_12 - -
- 3574438..3574518 - 81 NuclAT_12 - -
- 3574438..3574518 - 81 NuclAT_12 - -
- 3574438..3574518 - 81 NuclAT_12 - -
JMX26_RS17305 3575114..3575572 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
JMX26_RS17310 3575833..3577290 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
JMX26_RS17315 3577347..3577868 - 522 Protein_3385 peptide chain release factor H -
JMX26_RS17320 3577867..3578070 - 204 Protein_3386 RNA ligase RtcB family protein -
JMX26_RS17325 3578316..3578768 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
JMX26_RS17330 3578778..3579176 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
JMX26_RS17335 3579179..3579472 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
JMX26_RS17340 3579524..3580579 - 1056 WP_001226164.1 DNA polymerase IV -
JMX26_RS17345 3580650..3581573 - 924 WP_001468020.1 putative lateral flagellar export/assembly protein LafU -
JMX26_RS17350 3581576..3582439 - 864 WP_001169518.1 flagellar motor stator protein MotA -
JMX26_RS17355 3582452..3583171 - 720 WP_000938740.1 FliA/WhiG family RNA polymerase sigma factor -
JMX26_RS17360 3583191..3583658 - 468 WP_000725257.1 flagellar basal body-associated FliL family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fdeC / ykgK/ecpR 3531668..3579472 47804


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T292045 WP_001263493.1 NZ_LR898868:c3579176-3578778 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT292045 WP_000554757.1 NZ_LR898868:c3579472-3579179 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References