Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3578778..3579472 | Replicon | chromosome |
| Accession | NZ_LR898868 | ||
| Organism | Escherichia coli isolate MSB1_1D-sc-2280324 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1EXB8 |
| Locus tag | JMX26_RS17330 | Protein ID | WP_001263493.1 |
| Coordinates | 3578778..3579176 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | JMX26_RS17335 | Protein ID | WP_000554757.1 |
| Coordinates | 3579179..3579472 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX26_RS17300 | 3573778..3575022 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| - | 3574438..3574518 | - | 81 | NuclAT_12 | - | - |
| - | 3574438..3574518 | - | 81 | NuclAT_12 | - | - |
| - | 3574438..3574518 | - | 81 | NuclAT_12 | - | - |
| - | 3574438..3574518 | - | 81 | NuclAT_12 | - | - |
| JMX26_RS17305 | 3575114..3575572 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| JMX26_RS17310 | 3575833..3577290 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
| JMX26_RS17315 | 3577347..3577868 | - | 522 | Protein_3385 | peptide chain release factor H | - |
| JMX26_RS17320 | 3577867..3578070 | - | 204 | Protein_3386 | RNA ligase RtcB family protein | - |
| JMX26_RS17325 | 3578316..3578768 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
| JMX26_RS17330 | 3578778..3579176 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| JMX26_RS17335 | 3579179..3579472 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| JMX26_RS17340 | 3579524..3580579 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| JMX26_RS17345 | 3580650..3581573 | - | 924 | WP_001468020.1 | putative lateral flagellar export/assembly protein LafU | - |
| JMX26_RS17350 | 3581576..3582439 | - | 864 | WP_001169518.1 | flagellar motor stator protein MotA | - |
| JMX26_RS17355 | 3582452..3583171 | - | 720 | WP_000938740.1 | FliA/WhiG family RNA polymerase sigma factor | - |
| JMX26_RS17360 | 3583191..3583658 | - | 468 | WP_000725257.1 | flagellar basal body-associated FliL family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fdeC / ykgK/ecpR | 3531668..3579472 | 47804 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T292045 WP_001263493.1 NZ_LR898868:c3579176-3578778 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|