Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 601554..602335 | Replicon | chromosome |
Accession | NZ_LR898868 | ||
Organism | Escherichia coli isolate MSB1_1D-sc-2280324 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | - |
Locus tag | JMX26_RS02920 | Protein ID | WP_113417943.1 |
Coordinates | 601554..602000 (-) | Length | 149 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | JMX26_RS02925 | Protein ID | WP_001307405.1 |
Coordinates | 602000..602335 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX26_RS02895 | 596990..597868 | - | 879 | WP_130053258.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
JMX26_RS02900 | 597858..598637 | - | 780 | WP_000406209.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
JMX26_RS02905 | 598648..599121 | - | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
JMX26_RS02910 | 599144..600424 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
JMX26_RS02915 | 600672..601481 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
JMX26_RS02920 | 601554..602000 | - | 447 | WP_113417943.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
JMX26_RS02925 | 602000..602335 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
JMX26_RS02930 | 602484..604055 | - | 1572 | WP_130053259.1 | galactarate dehydratase | - |
JMX26_RS02935 | 604430..605764 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
JMX26_RS02940 | 605780..606550 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 149 a.a. Molecular weight: 17109.55 Da Isoelectric Point: 10.0993
>T292032 WP_113417943.1 NZ_LR898868:c602000-601554 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTR
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTR
Download Length: 447 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|