Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 5875867..5876462 | Replicon | chromosome |
| Accession | NZ_LR898867 | ||
| Organism | Pseudomonas aeruginosa isolate MINF_3A-sc-2280432 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | JMX72_RS27565 | Protein ID | WP_003113526.1 |
| Coordinates | 5876184..5876462 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A0S3KUN4 |
| Locus tag | JMX72_RS27560 | Protein ID | WP_003111575.1 |
| Coordinates | 5875867..5876172 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX72_RS27530 | 5870913..5871185 | - | 273 | WP_004352675.1 | hypothetical protein | - |
| JMX72_RS27535 | 5871632..5871923 | + | 292 | Protein_5442 | hypothetical protein | - |
| JMX72_RS27540 | 5871975..5873534 | - | 1560 | WP_201720842.1 | SIR2 family protein | - |
| JMX72_RS27545 | 5873548..5873919 | - | 372 | WP_079280107.1 | ASCH domain-containing protein | - |
| JMX72_RS27550 | 5873897..5874949 | - | 1053 | WP_023084818.1 | hypothetical protein | - |
| JMX72_RS27555 | 5874967..5875488 | - | 522 | WP_201720843.1 | AAA family ATPase | - |
| JMX72_RS27560 | 5875867..5876172 | - | 306 | WP_003111575.1 | HigA family addiction module antidote protein | Antitoxin |
| JMX72_RS27565 | 5876184..5876462 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JMX72_RS27570 | 5876791..5879019 | + | 2229 | WP_033991161.1 | TonB-dependent receptor | - |
| JMX72_RS27575 | 5879090..5879737 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| JMX72_RS27580 | 5879799..5881037 | - | 1239 | WP_031686604.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T292031 WP_003113526.1 NZ_LR898867:c5876462-5876184 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V6ALY3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3KUN4 |