Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 324276..324862 Replicon chromosome
Accession NZ_LR890735
Organism Klebsiella pneumoniae isolate INF323-sc-2280125

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag JMX74_RS01510 Protein ID WP_101985710.1
Coordinates 324494..324862 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag JMX74_RS01505 Protein ID WP_004174006.1
Coordinates 324276..324497 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX74_RS01485 320433..321359 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
JMX74_RS01490 321356..322633 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
JMX74_RS01495 322630..323397 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
JMX74_RS01500 323399..324112 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
JMX74_RS01505 324276..324497 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMX74_RS01510 324494..324862 + 369 WP_101985710.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMX74_RS01515 325135..326451 + 1317 WP_201720408.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
JMX74_RS01520 326558..327445 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
JMX74_RS01525 327442..328287 + 846 WP_004185988.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
JMX74_RS01530 328289..329359 + 1071 WP_201720409.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 321356..330096 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13595.95 Da        Isoelectric Point: 9.8261

>T291993 WP_101985710.1 NZ_LR890735:324494-324862 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQRTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT291993 WP_004174006.1 NZ_LR890735:324276-324497 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References