Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 1327..1957 | Replicon | plasmid 5 |
| Accession | NZ_LR890730 | ||
| Organism | Klebsiella pneumoniae isolate INF102-sc-2279897 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3V9PY09 |
| Locus tag | JMX38_RS27500 | Protein ID | WP_001708474.1 |
| Coordinates | 1622..1957 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A704FLZ1 |
| Locus tag | JMX38_RS27495 | Protein ID | WP_001708475.1 |
| Coordinates | 1327..1617 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX38_RS27490 | 614..1267 | - | 654 | WP_064163826.1 | hypothetical protein | - |
| JMX38_RS27495 | 1327..1617 | - | 291 | WP_001708475.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
| JMX38_RS27500 | 1622..1957 | - | 336 | WP_001708474.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JMX38_RS27505 | 2160..2465 | - | 306 | WP_181505416.1 | hypothetical protein | - |
| JMX38_RS27510 | 2567..2869 | - | 303 | WP_060436025.1 | hypothetical protein | - |
| JMX38_RS27515 | 3182..3742 | - | 561 | WP_060436024.1 | hypothetical protein | - |
| JMX38_RS27520 | 3760..4110 | - | 351 | WP_060436023.1 | hypothetical protein | - |
| JMX38_RS27525 | 4107..4376 | - | 270 | WP_060436022.1 | hypothetical protein | - |
| JMX38_RS27530 | 4390..4767 | - | 378 | WP_181505417.1 | hypothetical protein | - |
| JMX38_RS27535 | 4893..6872 | - | 1980 | WP_201553332.1 | DUF87 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..43065 | 43065 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12615.30 Da Isoelectric Point: 5.2407
>T291992 WP_001708474.1 NZ_LR890730:c1957-1622 [Klebsiella pneumoniae]
MEYYEFVETSVFTREMKTLLSDDEYKEFQTFLIENPEAGDLIVGTGGCRKVRWSRQGTGKSSGVRAIYYFYNPAGRLYML
IIYPKSEKDSLTAAEKNQLKAVVAGFKGEEG
MEYYEFVETSVFTREMKTLLSDDEYKEFQTFLIENPEAGDLIVGTGGCRKVRWSRQGTGKSSGVRAIYYFYNPAGRLYML
IIYPKSEKDSLTAAEKNQLKAVVAGFKGEEG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V9PY09 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A704FLZ1 |