Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 2372498..2373187 | Replicon | chromosome |
Accession | NZ_LR890722 | ||
Organism | Klebsiella pneumoniae isolate KSB1_1H |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A331C6E2 |
Locus tag | JMW72_RS11580 | Protein ID | WP_021469727.1 |
Coordinates | 2372498..2372815 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | JMW72_RS11585 | Protein ID | WP_040147778.1 |
Coordinates | 2372891..2373187 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW72_RS11550 | 2368200..2368709 | + | 510 | WP_002906702.1 | GNAT family N-acetyltransferase | - |
JMW72_RS11555 | 2368719..2369645 | + | 927 | WP_032416224.1 | amino acid ABC transporter permease | - |
JMW72_RS11560 | 2369629..2370408 | + | 780 | WP_002906697.1 | amino acid ABC transporter ATP-binding protein | - |
JMW72_RS11565 | 2370447..2371298 | + | 852 | WP_014343117.1 | transporter substrate-binding domain-containing protein | - |
JMW72_RS11570 | 2371376..2371993 | + | 618 | WP_040147782.1 | glutathione S-transferase family protein | - |
JMW72_RS11575 | 2372064..2372291 | + | 228 | WP_002906690.1 | tautomerase PptA | - |
JMW72_RS11580 | 2372498..2372815 | + | 318 | WP_021469727.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMW72_RS11585 | 2372891..2373187 | + | 297 | WP_040147778.1 | helix-turn-helix domain-containing protein | Antitoxin |
JMW72_RS11590 | 2373266..2373712 | + | 447 | WP_004175959.1 | hypothetical protein | - |
JMW72_RS11595 | 2373753..2375369 | - | 1617 | WP_040147777.1 | carbohydrate porin | - |
JMW72_RS11600 | 2375413..2376795 | - | 1383 | WP_099743292.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12221.10 Da Isoelectric Point: 10.2217
>T291969 WP_021469727.1 NZ_LR890722:2372498-2372815 [Klebsiella pneumoniae]
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|