Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 4083353..4084047 | Replicon | chromosome |
Accession | NZ_LR890714 | ||
Organism | Escherichia coli isolate MSB1_6C-sc-2280315 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q0T7Q5 |
Locus tag | JMW19_RS19490 | Protein ID | WP_001263491.1 |
Coordinates | 4083353..4083751 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | L4JHF0 |
Locus tag | JMW19_RS19495 | Protein ID | WP_000554755.1 |
Coordinates | 4083754..4084047 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW19_RS19460 | 4078522..4079766 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
- | 4079182..4079262 | - | 81 | NuclAT_11 | - | - |
- | 4079182..4079262 | - | 81 | NuclAT_11 | - | - |
- | 4079182..4079262 | - | 81 | NuclAT_11 | - | - |
- | 4079182..4079262 | - | 81 | NuclAT_11 | - | - |
JMW19_RS19465 | 4079858..4080316 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
JMW19_RS19470 | 4080577..4082034 | + | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
JMW19_RS19475 | 4082091..4082443 | - | 353 | Protein_3813 | peptide chain release factor H | - |
JMW19_RS19480 | 4082439..4082645 | - | 207 | Protein_3814 | RtcB family protein | - |
JMW19_RS19485 | 4082891..4083343 | - | 453 | WP_019842500.1 | GNAT family N-acetyltransferase | - |
JMW19_RS19490 | 4083353..4083751 | - | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
JMW19_RS19495 | 4083754..4084047 | - | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
JMW19_RS19500 | 4084099..4085154 | - | 1056 | WP_001550655.1 | DNA polymerase IV | - |
JMW19_RS19505 | 4085225..4086010 | - | 786 | WP_019842510.1 | putative lateral flagellar export/assembly protein LafU | - |
JMW19_RS19510 | 4085982..4087694 | + | 1713 | Protein_3820 | flagellar biosynthesis protein FlhA | - |
JMW19_RS19515 | 4087799..4088077 | + | 279 | WP_000598760.1 | type II toxin-antitoxin system HicA family toxin | - |
JMW19_RS19520 | 4088070..4088426 | + | 357 | WP_001030484.1 | type II toxin-antitoxin system HicB family antitoxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4073289..4084047 | 10758 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T291938 WP_001263491.1 NZ_LR890714:c4083751-4083353 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TPK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829G9H5 |