Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 34787..35040 Replicon plasmid 2
Accession NZ_LR890694
Organism Escherichia coli isolate MSB1_4E-sc-2280348

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag JMW23_RS24765 Protein ID WP_001312851.1
Coordinates 34787..34936 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 34981..35040 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW23_RS24730 30136..30551 - 416 Protein_33 IS1 family transposase -
JMW23_RS24735 30800..31201 - 402 WP_001398199.1 type II toxin-antitoxin system toxin endoribonuclease PemK -
JMW23_RS24740 31134..31391 - 258 WP_000557619.1 type II toxin-antitoxin system antitoxin PemI -
JMW23_RS24745 31484..32146 - 663 WP_001493766.1 CPBP family intramembrane metalloprotease -
JMW23_RS24750 33085..33942 - 858 WP_016240488.1 incFII family plasmid replication initiator RepA -
JMW23_RS24755 33935..34009 - 75 WP_001365705.1 RepA leader peptide Tap -
JMW23_RS24760 34254..34502 - 249 WP_000083839.1 replication regulatory protein RepA -
JMW23_RS24765 34787..34936 - 150 WP_001312851.1 type I toxin-antitoxin system Hok family toxin Toxin
- 34981..35040 + 60 NuclAT_1 - Antitoxin
- 34981..35040 + 60 NuclAT_1 - Antitoxin
- 34981..35040 + 60 NuclAT_1 - Antitoxin
- 34981..35040 + 60 NuclAT_1 - Antitoxin
JMW23_RS24770 35183..35656 - 474 WP_016240489.1 hypothetical protein -
JMW23_RS24775 35811..36401 - 591 WP_033807967.1 DUF2726 domain-containing protein -
JMW23_RS24780 36439..36648 - 210 WP_001298565.1 hemolysin expression modulator Hha -
JMW23_RS24785 36694..37155 - 462 WP_001233838.1 thermonuclease family protein -
JMW23_RS24790 37400..37612 - 213 WP_001309245.1 ANR family transcriptional regulator -
JMW23_RS24795 37741..38301 - 561 WP_000139321.1 fertility inhibition protein FinO -
JMW23_RS24800 38404..39264 - 861 WP_000704523.1 alpha/beta hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-27 senB 1..112822 112822


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T291876 WP_001312851.1 NZ_LR890694:c34936-34787 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 60 bp

>AT291876 NZ_LR890694:34981-35040 [Escherichia coli]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References