Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 3436559..3437161 | Replicon | chromosome |
Accession | NZ_LR890693 | ||
Organism | Escherichia coli isolate MSB1_4E-sc-2280348 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1P416 |
Locus tag | JMW23_RS16900 | Protein ID | WP_000897302.1 |
Coordinates | 3436559..3436870 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | JMW23_RS16905 | Protein ID | WP_000356397.1 |
Coordinates | 3436871..3437161 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW23_RS16875 | 3432473..3433072 | + | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
JMW23_RS16880 | 3433066..3433938 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
JMW23_RS16885 | 3433935..3434372 | + | 438 | WP_000560981.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
JMW23_RS16890 | 3434417..3435358 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
JMW23_RS16895 | 3435422..3436330 | - | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
JMW23_RS16900 | 3436559..3436870 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
JMW23_RS16905 | 3436871..3437161 | + | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
JMW23_RS16910 | 3437520..3437798 | + | 279 | WP_001296612.1 | hypothetical protein | - |
JMW23_RS16915 | 3438195..3438413 | + | 219 | WP_001251293.1 | ribbon-helix-helix domain-containing protein | - |
JMW23_RS16920 | 3438598..3439047 | - | 450 | WP_032140890.1 | hypothetical protein | - |
JMW23_RS16925 | 3439363..3440211 | - | 849 | WP_001038650.1 | hypothetical protein | - |
JMW23_RS16930 | 3440501..3440743 | + | 243 | WP_001068514.1 | ribbon-helix-helix domain-containing protein | - |
JMW23_RS16935 | 3440925..3441854 | - | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T291866 WP_000897302.1 NZ_LR890693:3436559-3436870 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|