Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 395619..395840 Replicon chromosome
Accession NZ_LR890693
Organism Escherichia coli isolate MSB1_4E-sc-2280348

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag JMW23_RS02150 Protein ID WP_001531632.1
Coordinates 395619..395726 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 395774..395840 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW23_RS02125 391463..392545 + 1083 WP_000804726.1 peptide chain release factor 1 -
JMW23_RS02130 392545..393378 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
JMW23_RS02135 393375..393767 + 393 WP_000200375.1 invasion regulator SirB2 -
JMW23_RS02140 393771..394580 + 810 WP_001257044.1 invasion regulator SirB1 -
JMW23_RS02145 394616..395470 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
JMW23_RS02150 395619..395726 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 395774..395840 + 67 NuclAT_10 - Antitoxin
- 395774..395840 + 67 NuclAT_10 - Antitoxin
- 395774..395840 + 67 NuclAT_10 - Antitoxin
- 395774..395840 + 67 NuclAT_10 - Antitoxin
- 395774..395840 + 67 NuclAT_5 - Antitoxin
- 395774..395840 + 67 NuclAT_5 - Antitoxin
- 395774..395840 + 67 NuclAT_5 - Antitoxin
- 395774..395840 + 67 NuclAT_5 - Antitoxin
- 395774..395840 + 67 NuclAT_6 - Antitoxin
- 395774..395840 + 67 NuclAT_6 - Antitoxin
- 395774..395840 + 67 NuclAT_6 - Antitoxin
- 395774..395840 + 67 NuclAT_6 - Antitoxin
- 395774..395840 + 67 NuclAT_7 - Antitoxin
- 395774..395840 + 67 NuclAT_7 - Antitoxin
- 395774..395840 + 67 NuclAT_7 - Antitoxin
- 395774..395840 + 67 NuclAT_7 - Antitoxin
- 395774..395840 + 67 NuclAT_8 - Antitoxin
- 395774..395840 + 67 NuclAT_8 - Antitoxin
- 395774..395840 + 67 NuclAT_8 - Antitoxin
- 395774..395840 + 67 NuclAT_8 - Antitoxin
- 395774..395840 + 67 NuclAT_9 - Antitoxin
- 395774..395840 + 67 NuclAT_9 - Antitoxin
- 395774..395840 + 67 NuclAT_9 - Antitoxin
- 395774..395840 + 67 NuclAT_9 - Antitoxin
- 395776..395839 + 64 NuclAT_12 - -
- 395776..395839 + 64 NuclAT_12 - -
- 395776..395839 + 64 NuclAT_12 - -
- 395776..395839 + 64 NuclAT_12 - -
- 395776..395839 + 64 NuclAT_13 - -
- 395776..395839 + 64 NuclAT_13 - -
- 395776..395839 + 64 NuclAT_13 - -
- 395776..395839 + 64 NuclAT_13 - -
- 395776..395839 + 64 NuclAT_14 - -
- 395776..395839 + 64 NuclAT_14 - -
- 395776..395839 + 64 NuclAT_14 - -
- 395776..395839 + 64 NuclAT_14 - -
- 395776..395839 + 64 NuclAT_15 - -
- 395776..395839 + 64 NuclAT_15 - -
- 395776..395839 + 64 NuclAT_15 - -
- 395776..395839 + 64 NuclAT_15 - -
- 395776..395839 + 64 NuclAT_16 - -
- 395776..395839 + 64 NuclAT_16 - -
- 395776..395839 + 64 NuclAT_16 - -
- 395776..395839 + 64 NuclAT_16 - -
- 395776..395839 + 64 NuclAT_17 - -
- 395776..395839 + 64 NuclAT_17 - -
- 395776..395839 + 64 NuclAT_17 - -
- 395776..395839 + 64 NuclAT_17 - -
- 395776..395841 + 66 NuclAT_18 - -
- 395776..395841 + 66 NuclAT_18 - -
- 395776..395841 + 66 NuclAT_18 - -
- 395776..395841 + 66 NuclAT_18 - -
- 395776..395841 + 66 NuclAT_19 - -
- 395776..395841 + 66 NuclAT_19 - -
- 395776..395841 + 66 NuclAT_19 - -
- 395776..395841 + 66 NuclAT_19 - -
- 395776..395841 + 66 NuclAT_20 - -
- 395776..395841 + 66 NuclAT_20 - -
- 395776..395841 + 66 NuclAT_20 - -
- 395776..395841 + 66 NuclAT_20 - -
- 395776..395841 + 66 NuclAT_21 - -
- 395776..395841 + 66 NuclAT_21 - -
- 395776..395841 + 66 NuclAT_21 - -
- 395776..395841 + 66 NuclAT_21 - -
- 395776..395841 + 66 NuclAT_22 - -
- 395776..395841 + 66 NuclAT_22 - -
- 395776..395841 + 66 NuclAT_22 - -
- 395776..395841 + 66 NuclAT_22 - -
- 395776..395841 + 66 NuclAT_23 - -
- 395776..395841 + 66 NuclAT_23 - -
- 395776..395841 + 66 NuclAT_23 - -
- 395776..395841 + 66 NuclAT_23 - -
JMW23_RS02155 396131..397231 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
JMW23_RS02160 397501..397740 + 240 WP_000120702.1 putative cation transport regulator ChaB -
JMW23_RS02165 397889..398584 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
JMW23_RS02170 398628..398981 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
JMW23_RS02175 399166..400560 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T291850 WP_001531632.1 NZ_LR890693:c395726-395619 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp


Antitoxin


Download         Length: 67 bp

>AT291850 NZ_LR890693:395774-395840 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9


Antitoxin

Download structure file

References