Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 721779..722554 | Replicon | chromosome |
Accession | NZ_LR890679 | ||
Organism | Klebsiella pneumoniae isolate INF279-sc-2280202 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A332L402 |
Locus tag | JMX25_RS03570 | Protein ID | WP_021314147.1 |
Coordinates | 722069..722554 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | JMX25_RS03565 | Protein ID | WP_004150912.1 |
Coordinates | 721779..722072 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX25_RS03545 | 716987..717589 | - | 603 | WP_021440720.1 | short chain dehydrogenase | - |
JMX25_RS03550 | 717687..718598 | + | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
JMX25_RS03555 | 718599..719747 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
JMX25_RS03560 | 719758..721134 | - | 1377 | WP_074194669.1 | cystathionine beta-synthase | - |
JMX25_RS03565 | 721779..722072 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
JMX25_RS03570 | 722069..722554 | + | 486 | WP_021314147.1 | GNAT family N-acetyltransferase | Toxin |
JMX25_RS03575 | 723258..723851 | + | 594 | WP_004188553.1 | hypothetical protein | - |
JMX25_RS03580 | 723948..724164 | + | 217 | Protein_701 | transposase | - |
JMX25_RS03585 | 724939..725823 | + | 885 | WP_013095145.1 | ParA family protein | - |
JMX25_RS03590 | 725816..727180 | + | 1365 | WP_044158999.1 | replicative DNA helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 723948..724100 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17621.68 Da Isoelectric Point: 8.5144
>T291801 WP_021314147.1 NZ_LR890679:722069-722554 [Klebsiella pneumoniae]
MILAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MILAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A332L402 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |