Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 336067..336653 Replicon chromosome
Accession NZ_LR890665
Organism Klebsiella pneumoniae isolate INF065-sc-2279980

Toxin (Protein)


Gene name doc Uniprot ID W9BMV7
Locus tag JMX32_RS01555 Protein ID WP_004185990.1
Coordinates 336285..336653 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag JMX32_RS01550 Protein ID WP_004174006.1
Coordinates 336067..336288 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX32_RS01530 332224..333150 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
JMX32_RS01535 333147..334424 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
JMX32_RS01540 334421..335188 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
JMX32_RS01545 335190..335903 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
JMX32_RS01550 336067..336288 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMX32_RS01555 336285..336653 + 369 WP_004185990.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMX32_RS01560 336926..338242 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
JMX32_RS01565 338349..339236 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
JMX32_RS01570 339233..340078 + 846 WP_004185988.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
JMX32_RS01575 340080..341150 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 333147..341887 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13469.85 Da        Isoelectric Point: 8.0667

>T291760 WP_004185990.1 NZ_LR890665:336285-336653 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVCRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT291760 WP_004174006.1 NZ_LR890665:336067-336288 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB W9BMV7

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References