Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 4443241..4443893 | Replicon | chromosome |
| Accession | NZ_LR890657 | ||
| Organism | Serratia marcescens isolate MSB1_9C-sc-2280320 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | JMX15_RS21350 | Protein ID | WP_038878669.1 |
| Coordinates | 4443241..4443585 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A8B4GZD7 |
| Locus tag | JMX15_RS21355 | Protein ID | WP_038878665.1 |
| Coordinates | 4443591..4443893 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX15_RS21335 | 4439397..4439582 | - | 186 | WP_038878678.1 | hypothetical protein | - |
| JMX15_RS21340 | 4439583..4441841 | - | 2259 | WP_038878674.1 | molybdopterin guanine dinucleotide-containing S/N-oxide reductase | - |
| JMX15_RS21345 | 4442062..4443081 | + | 1020 | WP_038878671.1 | HTH-type transcriptional regulator GalR | - |
| JMX15_RS21350 | 4443241..4443585 | + | 345 | WP_038878669.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JMX15_RS21355 | 4443591..4443893 | + | 303 | WP_038878665.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| JMX15_RS21360 | 4443921..4445183 | - | 1263 | WP_038878662.1 | diaminopimelate decarboxylase | - |
| JMX15_RS21365 | 4445317..4446240 | + | 924 | WP_038878659.1 | LysR family transcriptional regulator | - |
| JMX15_RS21370 | 4446268..4447176 | - | 909 | WP_038878655.1 | LysR family transcriptional regulator | - |
| JMX15_RS21375 | 4447285..4448169 | + | 885 | WP_201621402.1 | MBL fold metallo-hydrolase | - |
| JMX15_RS21380 | 4448238..4448885 | + | 648 | WP_038878652.1 | DsbA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13367.40 Da Isoelectric Point: 10.6629
>T291754 WP_038878669.1 NZ_LR890657:4443241-4443585 [Serratia marcescens]
MWQVVTVERFDDWFLALNNAQQTSILAAIFKLQTFGPQLARPHADTLHFSDAVRQLKELRIQHRGRPFRVFFAFDPQRQA
VLLCGGDKTGDQRFYQRMLPIAAMEFSHYLATRR
MWQVVTVERFDDWFLALNNAQQTSILAAIFKLQTFGPQLARPHADTLHFSDAVRQLKELRIQHRGRPFRVFFAFDPQRQA
VLLCGGDKTGDQRFYQRMLPIAAMEFSHYLATRR
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|