Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 172784..173038 | Replicon | plasmid 2 |
| Accession | NZ_LR890652 | ||
| Organism | Escherichia coli isolate MINF_2E-sc-2280463 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | - |
| Locus tag | JMW95_RS24845 | Protein ID | WP_001351576.1 |
| Coordinates | 172784..172990 (-) | Length | 69 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 172977..173038 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW95_RS24810 | 168323..168670 | + | 348 | Protein_178 | IS1-like element IS1A family transposase | - |
| JMW95_RS24815 | 169110..169397 | - | 288 | WP_000222760.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| JMW95_RS24820 | 169394..169645 | - | 252 | WP_001132900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| JMW95_RS24825 | 170612..171469 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| JMW95_RS24830 | 171462..171944 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| JMW95_RS24835 | 171937..172011 | - | 75 | WP_001442103.1 | RepA leader peptide Tap | - |
| JMW95_RS24840 | 172243..172500 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| JMW95_RS24845 | 172784..172990 | - | 207 | WP_001351576.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 172977..173038 | + | 62 | NuclAT_1 | - | Antitoxin |
| - | 172977..173038 | + | 62 | NuclAT_1 | - | Antitoxin |
| - | 172977..173038 | + | 62 | NuclAT_1 | - | Antitoxin |
| - | 172977..173038 | + | 62 | NuclAT_1 | - | Antitoxin |
| JMW95_RS24850 | 173294..173368 | - | 75 | Protein_186 | endonuclease | - |
| JMW95_RS24855 | 173614..173826 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| JMW95_RS24860 | 173962..174522 | - | 561 | WP_032072881.1 | fertility inhibition protein FinO | - |
| JMW95_RS24865 | 174625..175485 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| JMW95_RS24870 | 175544..176290 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD / blaCTX-M-14 | iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat | 1..207369 | 207369 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 69 a.a. Molecular weight: 7826.31 Da Isoelectric Point: 8.8807
>T291732 WP_001351576.1 NZ_LR890652:c172990-172784 [Escherichia coli]
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 207 bp
Antitoxin
Download Length: 62 bp
>AT291732 NZ_LR890652:172977-173038 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
