Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 6036..6462 | Replicon | plasmid 2 |
Accession | NZ_LR890652 | ||
Organism | Escherichia coli isolate MINF_2E-sc-2280463 |
Toxin (Protein)
Gene name | hok | Uniprot ID | B1VC78 |
Locus tag | JMW95_RS23970 | Protein ID | WP_001302184.1 |
Coordinates | 6036..6194 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 6238..6462 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW95_RS23940 | 1209..1604 | - | 396 | WP_001309237.1 | conjugal transfer relaxosome protein TraY | - |
JMW95_RS23945 | 1703..2392 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
JMW95_RS23950 | 2579..2962 | - | 384 | WP_001151524.1 | relaxosome protein TraM | - |
JMW95_RS23955 | 3283..3885 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
JMW95_RS23960 | 4182..5003 | - | 822 | WP_001234487.1 | DUF945 domain-containing protein | - |
JMW95_RS23965 | 5114..5410 | - | 297 | WP_001272245.1 | hypothetical protein | - |
JMW95_RS23970 | 6036..6194 | - | 159 | WP_001302184.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 6238..6462 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 6238..6462 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 6238..6462 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 6238..6462 | - | 225 | NuclAT_0 | - | Antitoxin |
JMW95_RS23975 | 6474..7193 | - | 720 | WP_001276236.1 | plasmid SOS inhibition protein A | - |
JMW95_RS23980 | 7190..7624 | - | 435 | WP_000845962.1 | conjugation system SOS inhibitor PsiB | - |
JMW95_RS23985 | 7693..9657 | - | 1965 | WP_068862930.1 | ParB/RepB/Spo0J family partition protein | - |
JMW95_RS23990 | 9721..9954 | - | 234 | WP_000005988.1 | DUF905 family protein | - |
JMW95_RS23995 | 9917..10549 | - | 633 | WP_039023645.1 | single-stranded DNA-binding protein | - |
JMW95_RS24000 | 10850..11281 | + | 432 | WP_077250869.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD / blaCTX-M-14 | iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat | 1..207369 | 207369 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6108.35 Da Isoelectric Point: 9.1977
>T291723 WP_001302184.1 NZ_LR890652:c6194-6036 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
Download Length: 159 bp
Antitoxin
Download Length: 225 bp
>AT291723 NZ_LR890652:c6462-6238 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGATTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGATTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|