Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4739132..4739734 | Replicon | chromosome |
Accession | NZ_LR890651 | ||
Organism | Escherichia coli isolate MINF_2E-sc-2280463 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | JMW95_RS22940 | Protein ID | WP_000897305.1 |
Coordinates | 4739423..4739734 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | JMW95_RS22935 | Protein ID | WP_000356397.1 |
Coordinates | 4739132..4739422 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW95_RS22910 | 4735058..4735960 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
JMW95_RS22915 | 4735957..4736592 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
JMW95_RS22920 | 4736589..4737518 | + | 930 | WP_001749031.1 | formate dehydrogenase accessory protein FdhE | - |
JMW95_RS22925 | 4737848..4738090 | - | 243 | WP_001086388.1 | hypothetical protein | - |
JMW95_RS22930 | 4738309..4738527 | - | 219 | WP_001295676.1 | ribbon-helix-helix domain-containing protein | - |
JMW95_RS22935 | 4739132..4739422 | - | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
JMW95_RS22940 | 4739423..4739734 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
JMW95_RS22945 | 4739963..4740871 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
JMW95_RS22950 | 4740935..4741876 | - | 942 | WP_001343389.1 | fatty acid biosynthesis protein FabY | - |
JMW95_RS22955 | 4741921..4742358 | - | 438 | WP_000560983.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
JMW95_RS22960 | 4742355..4743227 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
JMW95_RS22965 | 4743221..4743820 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
JMW95_RS22970 | 4743919..4744704 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T291722 WP_000897305.1 NZ_LR890651:c4739734-4739423 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|