Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 1318..1948 | Replicon | plasmid 3 |
| Accession | NZ_LR890645 | ||
| Organism | Klebsiella pneumoniae isolate INF346-sc-2280166 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3V9PY09 |
| Locus tag | JMW14_RS25710 | Protein ID | WP_001708474.1 |
| Coordinates | 1613..1948 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A704FLZ1 |
| Locus tag | JMW14_RS25705 | Protein ID | WP_001708475.1 |
| Coordinates | 1318..1608 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW14_RS25700 | 605..1258 | - | 654 | WP_001708476.1 | hypothetical protein | - |
| JMW14_RS25705 | 1318..1608 | - | 291 | WP_001708475.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
| JMW14_RS25710 | 1613..1948 | - | 336 | WP_001708474.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JMW14_RS25715 | 2153..2821 | - | 669 | WP_044296050.1 | hypothetical protein | - |
| JMW14_RS25720 | 2871..3197 | - | 327 | WP_044296048.1 | hypothetical protein | - |
| JMW14_RS25725 | 3510..4070 | - | 561 | WP_052957587.1 | hypothetical protein | - |
| JMW14_RS25730 | 4088..4438 | - | 351 | WP_142762106.1 | hypothetical protein | - |
| JMW14_RS25735 | 4473..4808 | - | 336 | WP_094340933.1 | hypothetical protein | - |
| JMW14_RS25740 | 4805..5074 | - | 270 | WP_024172976.1 | hypothetical protein | - |
| JMW14_RS25745 | 5088..5465 | - | 378 | WP_069346704.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..44191 | 44191 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12615.30 Da Isoelectric Point: 5.2407
>T291689 WP_001708474.1 NZ_LR890645:c1948-1613 [Klebsiella pneumoniae]
MEYYEFVETSVFTREMKTLLSDDEYKEFQTFLIENPEAGDLIVGTGGCRKVRWSRQGTGKSSGVRAIYYFYNPAGRLYML
IIYPKSEKDSLTAAEKNQLKAVVAGFKGEEG
MEYYEFVETSVFTREMKTLLSDDEYKEFQTFLIENPEAGDLIVGTGGCRKVRWSRQGTGKSSGVRAIYYFYNPAGRLYML
IIYPKSEKDSLTAAEKNQLKAVVAGFKGEEG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V9PY09 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A704FLZ1 |