Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 362096..362742 | Replicon | chromosome |
Accession | NZ_LR890643 | ||
Organism | Klebsiella pneumoniae isolate INF346-sc-2280166 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A483JFR4 |
Locus tag | JMW14_RS01675 | Protein ID | WP_004188313.1 |
Coordinates | 362096..362443 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A483GM64 |
Locus tag | JMW14_RS01680 | Protein ID | WP_004188315.1 |
Coordinates | 362443..362742 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW14_RS01665 | 358022..359455 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
JMW14_RS01670 | 359473..361920 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
JMW14_RS01675 | 362096..362443 | + | 348 | WP_004188313.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMW14_RS01680 | 362443..362742 | + | 300 | WP_004188315.1 | XRE family transcriptional regulator | Antitoxin |
JMW14_RS01685 | 362805..364313 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
JMW14_RS01690 | 364518..364847 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
JMW14_RS01695 | 364898..365728 | + | 831 | WP_004188317.1 | rhomboid family intramembrane serine protease GlpG | - |
JMW14_RS01700 | 365778..366536 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13548.57 Da Isoelectric Point: 6.2327
>T291675 WP_004188313.1 NZ_LR890643:362096-362443 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A483JFR4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A483GM64 |