Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/RelE-HTH
Location 51970..52644 Replicon plasmid 2
Accession NZ_LR890641
Organism Klebsiella pneumoniae isolate INF344-sc-2280162

Toxin (Protein)


Gene name higB Uniprot ID A0A5Q9LMS5
Locus tag JMW76_RS25155 Protein ID WP_032720638.1
Coordinates 51970..52293 (+) Length 108 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag JMW76_RS25160 Protein ID WP_032720637.1
Coordinates 52342..52644 (+) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW76_RS25130 46996..47319 + 324 WP_019725650.1 hypothetical protein -
JMW76_RS25135 47790..48494 - 705 WP_031591821.1 toll/interleukin-1 receptor domain-containing protein -
JMW76_RS25140 48654..50000 - 1347 WP_077251107.1 ISNCY family transposase -
JMW76_RS25145 50311..50913 + 603 Protein_55 transposase -
JMW76_RS25150 51240..51792 + 553 Protein_56 DUF4113 domain-containing protein -
JMW76_RS25155 51970..52293 + 324 WP_032720638.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
JMW76_RS25160 52342..52644 + 303 WP_032720637.1 helix-turn-helix domain-containing protein Antitoxin
JMW76_RS25165 52687..52854 - 168 WP_153591440.1 hypothetical protein -
JMW76_RS25170 53042..53221 - 180 WP_032720701.1 hypothetical protein -
JMW76_RS25175 53245..53628 - 384 WP_032720636.1 hypothetical protein -
JMW76_RS25180 53733..54305 - 573 WP_032720635.1 GNAT family N-acetyltransferase -
JMW76_RS25185 54307..55095 - 789 WP_032720700.1 TSUP family transporter -
JMW76_RS25190 55131..56051 - 921 WP_050548604.1 TauD/TfdA family dioxygenase -
JMW76_RS25195 56354..56848 - 495 WP_044266755.1 hypothetical protein -
JMW76_RS25200 56879..57451 - 573 WP_044266753.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / qnrB1 / dfrA14 / blaCTX-M-15 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B - 1..190324 190324


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-2

(45-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(39-83)


Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12372.29 Da        Isoelectric Point: 9.6240

>T291669 WP_032720638.1 NZ_LR890641:51970-52293 [Klebsiella pneumoniae]
MNYLEFVETSAFSGLRKELMDDDEFRELQTYLLEAHDRGDTISHTGGCRKIRWGRPGMGKRGGVRVIYYVRLASGRLYLL
LIYPKNAKDELSEKEKAVMKALTQQLK

Download         Length: 324 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11211.12 Da        Isoelectric Point: 7.3611

>AT291669 WP_032720637.1 NZ_LR890641:52342-52644 [Klebsiella pneumoniae]
MEKKLFDALISSMEEMVAIENGQIQPAAEQVHRHTLPDVKAIRKHAGMKQAEFAEVVGASVDLVRSWEQQRRVPSGIALK
MLCLIEREPALINTLRGIHV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Q9LMS5

Antitoxin

Source ID Structure

References