Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4531784..4532559 | Replicon | chromosome |
Accession | NZ_LR890640 | ||
Organism | Klebsiella pneumoniae isolate INF344-sc-2280162 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A332L402 |
Locus tag | JMW76_RS22045 | Protein ID | WP_021314147.1 |
Coordinates | 4532074..4532559 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | JMW76_RS22040 | Protein ID | WP_004150912.1 |
Coordinates | 4531784..4532077 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW76_RS22020 | 4526992..4527594 | - | 603 | WP_004174410.1 | short chain dehydrogenase | - |
JMW76_RS22025 | 4527692..4528603 | + | 912 | WP_201524319.1 | LysR family transcriptional regulator | - |
JMW76_RS22030 | 4528604..4529752 | - | 1149 | WP_020316731.1 | PLP-dependent aspartate aminotransferase family protein | - |
JMW76_RS22035 | 4529763..4531139 | - | 1377 | WP_004174417.1 | pyridoxal-phosphate dependent enzyme | - |
JMW76_RS22040 | 4531784..4532077 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
JMW76_RS22045 | 4532074..4532559 | + | 486 | WP_021314147.1 | GNAT family N-acetyltransferase | Toxin |
JMW76_RS22050 | 4533263..4533856 | + | 594 | WP_004188553.1 | hypothetical protein | - |
JMW76_RS22055 | 4533953..4534169 | + | 217 | Protein_4302 | transposase | - |
JMW76_RS22065 | 4534684..4535397 | - | 714 | WP_002916694.1 | DUF554 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 4533953..4534105 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17621.68 Da Isoelectric Point: 8.5144
>T291667 WP_021314147.1 NZ_LR890640:4532074-4532559 [Klebsiella pneumoniae]
MILAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MILAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A332L402 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |