Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4130536..4131122 Replicon chromosome
Accession NZ_LR890640
Organism Klebsiella pneumoniae isolate INF344-sc-2280162

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag JMW76_RS19935 Protein ID WP_002920800.1
Coordinates 4130754..4131122 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A485URP3
Locus tag JMW76_RS19930 Protein ID WP_040226701.1
Coordinates 4130536..4130757 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW76_RS19910 4126693..4127619 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
JMW76_RS19915 4127616..4128893 + 1278 WP_201524314.1 branched chain amino acid ABC transporter permease LivM -
JMW76_RS19920 4128890..4129657 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
JMW76_RS19925 4129659..4130372 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
JMW76_RS19930 4130536..4130757 + 222 WP_040226701.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMW76_RS19935 4130754..4131122 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMW76_RS19940 4131395..4132711 + 1317 WP_040226700.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
JMW76_RS19945 4132818..4133705 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
JMW76_RS19950 4133702..4134547 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
JMW76_RS19955 4134549..4135619 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 4127616..4136356 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T291666 WP_002920800.1 NZ_LR890640:4130754-4131122 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8183.21 Da        Isoelectric Point: 4.7769

>AT291666 WP_040226701.1 NZ_LR890640:4130536-4130757 [Klebsiella pneumoniae]
MRTVNYSEARQNLADMLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A485URP3

References