Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 2402423..2403020 | Replicon | chromosome |
Accession | NZ_LR890640 | ||
Organism | Klebsiella pneumoniae isolate INF344-sc-2280162 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A9J6S5A1 |
Locus tag | JMW76_RS11790 | Protein ID | WP_004893639.1 |
Coordinates | 2402703..2403020 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | R4YH91 |
Locus tag | JMW76_RS11785 | Protein ID | WP_004142561.1 |
Coordinates | 2402423..2402710 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW76_RS11755 | 2398503..2398751 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
JMW76_RS11760 | 2398769..2399110 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
JMW76_RS11765 | 2399141..2400256 | - | 1116 | WP_012737592.1 | MBL fold metallo-hydrolase | - |
JMW76_RS11770 | 2400436..2401020 | + | 585 | WP_002893026.1 | TetR/AcrR family transcriptional regulator | - |
JMW76_RS11775 | 2401017..2401385 | + | 369 | WP_002893024.1 | MmcQ/YjbR family DNA-binding protein | - |
JMW76_RS11780 | 2401505..2402158 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
JMW76_RS11785 | 2402423..2402710 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
JMW76_RS11790 | 2402703..2403020 | - | 318 | WP_004893639.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMW76_RS11795 | 2403205..2404248 | - | 1044 | WP_021314069.1 | DUF2157 domain-containing protein | - |
JMW76_RS11800 | 2404914..2405780 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
JMW76_RS11805 | 2405889..2407316 | + | 1428 | WP_004176980.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12100.35 Da Isoelectric Point: 11.2767
>T291660 WP_004893639.1 NZ_LR890640:c2403020-2402703 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPSIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPSIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|