Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 13618..14275 | Replicon | plasmid 3 |
Accession | NZ_LR890634 | ||
Organism | Klebsiella pneumoniae isolate INF299-sc-2280084 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U3PDC3 |
Locus tag | JMX65_RS28000 | Protein ID | WP_000270043.1 |
Coordinates | 13925..14275 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | JMX65_RS27995 | Protein ID | WP_000124640.1 |
Coordinates | 13618..13920 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX65_RS27950 | 9243..9671 | + | 429 | WP_000591074.1 | hypothetical protein | - |
JMX65_RS27955 | 9728..10087 | + | 360 | WP_000422768.1 | hypothetical protein | - |
JMX65_RS27960 | 10087..10533 | + | 447 | WP_000919345.1 | Fe3+-siderophore ABC transporter permease | - |
JMX65_RS27965 | 10530..11048 | + | 519 | WP_000210756.1 | nitrite reductase | - |
JMX65_RS27970 | 11048..11278 | + | 231 | WP_000972663.1 | hypothetical protein | - |
JMX65_RS27975 | 11265..12122 | + | 858 | WP_001167032.1 | hypothetical protein | - |
JMX65_RS27980 | 12353..12880 | + | 528 | WP_001236377.1 | thermonuclease family protein | - |
JMX65_RS27985 | 12938..13210 | + | 273 | WP_001043047.1 | HU family DNA-binding protein | - |
JMX65_RS27990 | 13298..13591 | + | 294 | WP_001239997.1 | chromosome segregation protein ParM | - |
JMX65_RS27995 | 13618..13920 | - | 303 | WP_000124640.1 | XRE family transcriptional regulator | Antitoxin |
JMX65_RS28000 | 13925..14275 | - | 351 | WP_000270043.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMX65_RS28005 | 14438..14986 | + | 549 | WP_001061574.1 | transcriptional regulator | - |
JMX65_RS28010 | 15327..15521 | + | 195 | WP_000343597.1 | hypothetical protein | - |
JMX65_RS28015 | 15532..15903 | + | 372 | WP_000516916.1 | hypothetical protein | - |
JMX65_RS28020 | 15896..16366 | + | 471 | WP_001281821.1 | hypothetical protein | - |
JMX65_RS28025 | 16381..16716 | - | 336 | WP_000683476.1 | hypothetical protein | - |
JMX65_RS28030 | 16813..17301 | + | 489 | WP_001273096.1 | DUF1643 domain-containing protein | - |
JMX65_RS28035 | 17304..17801 | + | 498 | WP_000062185.1 | hypothetical protein | - |
JMX65_RS28040 | 18016..18720 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | dfrA23 / blaVEB-1 / ant(2'')-Ia / ARR-3 / cmlA1 / blaOXA-10 / ant(3'')-Ia / qacE / floR / tet(G) / rmtB / blaTEM-1B / blaCTX-M-15 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 | - | 1..128238 | 128238 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13328.21 Da Isoelectric Point: 5.2421
>T291648 WP_000270043.1 NZ_LR890634:c14275-13925 [Klebsiella pneumoniae]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|