Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 5082896..5083493 | Replicon | chromosome |
Accession | NZ_LR890632 | ||
Organism | Klebsiella pneumoniae isolate INF299-sc-2280084 |
Toxin (Protein)
Gene name | higB | Uniprot ID | R4YIC5 |
Locus tag | JMX65_RS25000 | Protein ID | WP_004142563.1 |
Coordinates | 5082896..5083213 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | R4YH91 |
Locus tag | JMX65_RS25005 | Protein ID | WP_004142561.1 |
Coordinates | 5083206..5083493 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX65_RS24985 | 5078596..5080023 | - | 1428 | WP_009308097.1 | MFS transporter | - |
JMX65_RS24990 | 5080132..5080998 | + | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
JMX65_RS24995 | 5081668..5082711 | + | 1044 | WP_040153598.1 | DUF2157 domain-containing protein | - |
JMX65_RS25000 | 5082896..5083213 | + | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMX65_RS25005 | 5083206..5083493 | + | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
JMX65_RS25010 | 5083758..5084396 | - | 639 | WP_064277739.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
JMX65_RS25015 | 5084516..5084884 | - | 369 | WP_040171587.1 | MmcQ/YjbR family DNA-binding protein | - |
JMX65_RS25020 | 5084881..5085465 | - | 585 | WP_094067239.1 | TetR/AcrR family transcriptional regulator | - |
JMX65_RS25025 | 5085645..5086760 | + | 1116 | WP_012737592.1 | MBL fold metallo-hydrolase | - |
JMX65_RS25030 | 5086791..5087132 | + | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
JMX65_RS25035 | 5087150..5087398 | - | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T291646 WP_004142563.1 NZ_LR890632:5082896-5083213 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M5MXH8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3DIQ1 |