Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 730393..731168 | Replicon | chromosome |
Accession | NZ_LR890624 | ||
Organism | Klebsiella pneumoniae isolate INF242-sc-2280140 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1W1JAQ8 |
Locus tag | JMX20_RS03640 | Protein ID | WP_009308645.1 |
Coordinates | 730683..731168 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | JMX20_RS03635 | Protein ID | WP_004150912.1 |
Coordinates | 730393..730686 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX20_RS03615 | 725603..726205 | - | 603 | WP_004174410.1 | short chain dehydrogenase | - |
JMX20_RS03620 | 726303..727214 | + | 912 | WP_015958983.1 | LysR family transcriptional regulator | - |
JMX20_RS03625 | 727215..728363 | - | 1149 | WP_065805152.1 | PLP-dependent aspartate aminotransferase family protein | - |
JMX20_RS03630 | 728374..729750 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
JMX20_RS03635 | 730393..730686 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
JMX20_RS03640 | 730683..731168 | + | 486 | WP_009308645.1 | GNAT family N-acetyltransferase | Toxin |
JMX20_RS03645 | 731872..732464 | + | 593 | Protein_715 | hypothetical protein | - |
JMX20_RS03650 | 732561..732777 | + | 217 | Protein_716 | transposase | - |
JMX20_RS03660 | 733455..734168 | - | 714 | WP_002916694.1 | DUF554 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 732561..732713 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17595.60 Da Isoelectric Point: 8.5144
>T291618 WP_009308645.1 NZ_LR890624:730683-731168 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1W1JAQ8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |