Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5238195..5238790 | Replicon | chromosome |
Accession | NZ_LR890619 | ||
Organism | Pseudomonas aeruginosa isolate MINF_7A-sc-2280434 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | JMW66_RS24260 | Protein ID | WP_003113526.1 |
Coordinates | 5238512..5238790 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | JMW66_RS24255 | Protein ID | WP_003113527.1 |
Coordinates | 5238195..5238500 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW66_RS24215 | 5233307..5233597 | - | 291 | WP_023088865.1 | DUF5447 family protein | - |
JMW66_RS24220 | 5233601..5233783 | - | 183 | WP_124129801.1 | hypothetical protein | - |
JMW66_RS24225 | 5233773..5234045 | - | 273 | WP_004352675.1 | hypothetical protein | - |
JMW66_RS24230 | 5234155..5234421 | + | 267 | WP_023088595.1 | hypothetical protein | - |
JMW66_RS24235 | 5234477..5234812 | + | 336 | WP_031756230.1 | hypothetical protein | - |
JMW66_RS24240 | 5234867..5236564 | - | 1698 | WP_074222664.1 | DUF2326 domain-containing protein | - |
JMW66_RS24245 | 5236771..5237319 | - | 549 | WP_031756228.1 | hypothetical protein | - |
JMW66_RS24250 | 5237327..5237581 | - | 255 | WP_071575691.1 | hypothetical protein | - |
JMW66_RS24255 | 5238195..5238500 | - | 306 | WP_003113527.1 | HigA family addiction module antidote protein | Antitoxin |
JMW66_RS24260 | 5238512..5238790 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMW66_RS24265 | 5239119..5241347 | + | 2229 | WP_023086667.1 | TonB-dependent receptor | - |
JMW66_RS24270 | 5241417..5242064 | - | 648 | WP_096264608.1 | carbonate dehydratase | - |
JMW66_RS24275 | 5242126..5243364 | - | 1239 | WP_201522542.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T291598 WP_003113526.1 NZ_LR890619:c5238790-5238512 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|