291578

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 328785..329371 Replicon chromosome
Accession NZ_LR890616
Organism Klebsiella pneumoniae isolate INF359-sc-2280194

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag JMX12_RS01535 Protein ID WP_023285605.1
Coordinates 329003..329371 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag JMX12_RS01530 Protein ID WP_004174006.1
Coordinates 328785..329006 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX12_RS01510 324942..325868 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
JMX12_RS01515 325865..327142 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
JMX12_RS01520 327139..327906 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
JMX12_RS01525 327908..328621 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
JMX12_RS01530 328785..329006 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMX12_RS01535 329003..329371 + 369 WP_023285605.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMX12_RS01540 329644..330960 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
JMX12_RS01545 331067..331954 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
JMX12_RS01550 331951..332796 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
JMX12_RS01555 332798..333868 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 325865..334605 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13534.89 Da        Isoelectric Point: 8.6410

>T291578 WP_023285605.1 NZ_LR890616:329003-329371 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGITVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT291578 WP_004174006.1 NZ_LR890616:328785-329006 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References