Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 337493..338079 Replicon chromosome
Accession NZ_LR890600
Organism Klebsiella pneumoniae isolate INF122-sc-2279936

Toxin (Protein)


Gene name doc Uniprot ID A0A331ME34
Locus tag JMW81_RS01570 Protein ID WP_025861226.1
Coordinates 337711..338079 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag JMW81_RS01565 Protein ID WP_004174006.1
Coordinates 337493..337714 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW81_RS01545 333649..334575 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
JMW81_RS01550 334572..335849 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
JMW81_RS01555 335846..336613 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
JMW81_RS01560 336615..337328 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
JMW81_RS01565 337493..337714 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMW81_RS01570 337711..338079 + 369 WP_025861226.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMW81_RS01575 338352..339668 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
JMW81_RS01580 339775..340662 + 888 WP_014906831.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
JMW81_RS01585 340659..341504 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
JMW81_RS01590 341506..342576 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 334572..343313 8741


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13551.98 Da        Isoelectric Point: 8.6410

>T291494 WP_025861226.1 NZ_LR890600:337711-338079 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGIKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT291494 WP_004174006.1 NZ_LR890600:337493-337714 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A331ME34

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References