Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 322833..323419 Replicon chromosome
Accession NZ_LR890571
Organism Klebsiella pneumoniae isolate INF327-sc-2280132

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag JMX40_RS01490 Protein ID WP_002920800.1
Coordinates 323051..323419 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag JMX40_RS01485 Protein ID WP_002920802.1
Coordinates 322833..323054 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX40_RS01465 318990..319916 + 927 WP_040146718.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
JMX40_RS01470 319913..321190 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
JMX40_RS01475 321187..321954 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
JMX40_RS01480 321956..322669 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
JMX40_RS01485 322833..323054 + 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMX40_RS01490 323051..323419 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMX40_RS01495 323692..325008 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
JMX40_RS01500 325115..326002 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
JMX40_RS01505 325999..326844 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
JMX40_RS01510 326846..327916 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 319913..328653 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T291448 WP_002920800.1 NZ_LR890571:323051-323419 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT291448 WP_002920802.1 NZ_LR890571:322833-323054 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References