Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 388091..388737 | Replicon | chromosome |
| Accession | NZ_LR890562 | ||
| Organism | Klebsiella pneumoniae isolate INF247-sc-2280148 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A483JFR4 |
| Locus tag | JMW77_RS01900 | Protein ID | WP_004188313.1 |
| Coordinates | 388091..388438 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A483GM64 |
| Locus tag | JMW77_RS01905 | Protein ID | WP_004188315.1 |
| Coordinates | 388438..388737 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW77_RS01890 | 384017..385450 | + | 1434 | WP_201527013.1 | glycogen synthase GlgA | - |
| JMW77_RS01895 | 385468..387915 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
| JMW77_RS01900 | 388091..388438 | + | 348 | WP_004188313.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JMW77_RS01905 | 388438..388737 | + | 300 | WP_004188315.1 | XRE family transcriptional regulator | Antitoxin |
| JMW77_RS01910 | 388800..390308 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
| JMW77_RS01915 | 390513..390842 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
| JMW77_RS01920 | 390893..391723 | + | 831 | WP_109139581.1 | rhomboid family intramembrane serine protease GlpG | - |
| JMW77_RS01925 | 391773..392531 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13548.57 Da Isoelectric Point: 6.2327
>T291400 WP_004188313.1 NZ_LR890562:388091-388438 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A483JFR4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A483GM64 |