Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 4189058..4189644 | Replicon | chromosome |
| Accession | NZ_LR890556 | ||
| Organism | Klebsiella pneumoniae isolate INF302-sc-2280090 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | W8VD46 |
| Locus tag | JMW84_RS20085 | Protein ID | WP_002920800.1 |
| Coordinates | 4189276..4189644 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | A0A0H3GZM4 |
| Locus tag | JMW84_RS20080 | Protein ID | WP_002920802.1 |
| Coordinates | 4189058..4189279 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW84_RS20060 | 4185215..4186141 | + | 927 | WP_040146718.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| JMW84_RS20065 | 4186138..4187415 | + | 1278 | WP_004174005.1 | branched chain amino acid ABC transporter permease LivM | - |
| JMW84_RS20070 | 4187412..4188179 | + | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| JMW84_RS20075 | 4188181..4188894 | + | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| JMW84_RS20080 | 4189058..4189279 | + | 222 | WP_002920802.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| JMW84_RS20085 | 4189276..4189644 | + | 369 | WP_002920800.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| JMW84_RS20090 | 4189917..4191233 | + | 1317 | WP_004174008.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| JMW84_RS20095 | 4191340..4192227 | + | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| JMW84_RS20100 | 4192224..4193069 | + | 846 | WP_004145129.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| JMW84_RS20105 | 4193071..4194141 | + | 1071 | WP_004150074.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 4186138..4194878 | 8740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13552.92 Da Isoelectric Point: 8.6410
>T291395 WP_002920800.1 NZ_LR890556:4189276-4189644 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GUD1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZM4 |