Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4189058..4189644 Replicon chromosome
Accession NZ_LR890556
Organism Klebsiella pneumoniae isolate INF302-sc-2280090

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag JMW84_RS20085 Protein ID WP_002920800.1
Coordinates 4189276..4189644 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag JMW84_RS20080 Protein ID WP_002920802.1
Coordinates 4189058..4189279 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW84_RS20060 4185215..4186141 + 927 WP_040146718.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
JMW84_RS20065 4186138..4187415 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
JMW84_RS20070 4187412..4188179 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
JMW84_RS20075 4188181..4188894 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
JMW84_RS20080 4189058..4189279 + 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMW84_RS20085 4189276..4189644 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMW84_RS20090 4189917..4191233 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
JMW84_RS20095 4191340..4192227 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
JMW84_RS20100 4192224..4193069 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
JMW84_RS20105 4193071..4194141 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 4186138..4194878 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T291395 WP_002920800.1 NZ_LR890556:4189276-4189644 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT291395 WP_002920802.1 NZ_LR890556:4189058-4189279 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References